Comparing CA265_RS11590 FitnessBrowser__Pedo557:CA265_RS11590 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2ismB Crystal structure of the putative oxidoreductase (glucose dehydrogenase) (ttha0570) from thermus theromophilus hb8
29% identity, 31% coverage: 49:329/902 of query aligns to 2:233/333 of 2ismB
Sites not aligning to the query:
P75804 Aldose sugar dehydrogenase YliI; Asd; Soluble aldose sugar dehydrogenase YliI; EC 1.1.5.- from Escherichia coli (strain K12) (see paper)
25% identity, 46% coverage: 49:464/902 of query aligns to 25:356/371 of P75804
2g8sA Crystal structure of the soluble aldose sugar dehydrogenase (asd) from escherichia coli in the apo-form (see paper)
25% identity, 46% coverage: 49:464/902 of query aligns to 3:334/348 of 2g8sA
3a9hA Crystal structure of pqq-dependent sugar dehydrogenase holo-form (see paper)
28% identity, 31% coverage: 50:327/902 of query aligns to 5:225/338 of 3a9hA
Sites not aligning to the query:
3a9gA Crystal structure of pqq-dependent sugar dehydrogenase apo-form (see paper)
28% identity, 31% coverage: 50:327/902 of query aligns to 5:225/338 of 3a9gA
Sites not aligning to the query:
1a56A Primary sequence and solution conformation of ferricytochromE C-552 from nitrosomonas europaea, nmr, mean structure refined with explicit hydrogen bond constraints (see paper)
43% identity, 8% coverage: 651:724/902 of query aligns to 7:80/81 of 1a56A
7cdyA Crystal structure of glucose dehydrogenase
25% identity, 31% coverage: 51:331/902 of query aligns to 3:238/346 of 7cdyA
3dasA Structure of the pqq-bound form of aldose sugar dehydrogenase (adh) from streptomyces coelicolor
28% identity, 32% coverage: 49:336/902 of query aligns to 8:240/334 of 3dasA
Sites not aligning to the query:
1corA Investigation of the solution conformation of cytochromE C-551 from pseudomonas stutzeri (see paper)
41% identity, 9% coverage: 645:723/902 of query aligns to 3:80/82 of 1corA
5xecA Heterodimer constructed from pa cyt c551-ht cyt c552 and ht cyt c552- pa cyt c551 chimeric proteins (see paper)
42% identity, 8% coverage: 654:724/902 of query aligns to 12:81/82 of 5xecA
5aurA Hydrogenobacter thermophilus cytochrome c552 dimer formed by domain swapping at n-terminal region (see paper)
42% identity, 8% coverage: 654:724/902 of query aligns to 10:82/83 of 5aurA
6kq1A Crystal structure of cytochrome c551 from pseudomonas sp. Strain mt-1.
36% identity, 9% coverage: 645:724/902 of query aligns to 3:81/82 of 6kq1A
Sites not aligning to the query:
7cgzA Glucose dehydrogenase
24% identity, 30% coverage: 51:321/902 of query aligns to 3:227/321 of 7cgzA
2d0sA Crystal structure of the cytochrome c552 from moderate thermophilic bacterium, hydrogenophilus thermoluteolus (see paper)
41% identity, 8% coverage: 654:724/902 of query aligns to 10:78/79 of 2d0sA
1cchA The solution conformation of cytochromE C-551 from p.Stutzeri zobell determined by nmr+ (see paper)
36% identity, 9% coverage: 645:724/902 of query aligns to 3:81/82 of 1cchA
1cq1A Soluble quinoprotein glucose dehydrogenase from acinetobacter calcoaceticus in complex with pqqh2 and glucose (see paper)
25% identity, 32% coverage: 35:327/902 of query aligns to 9:264/444 of 1cq1A
Sites not aligning to the query:
1c9uA Crystal structure of the soluble quinoprotein glucose dehydrogenase in complex with pqq (see paper)
25% identity, 32% coverage: 35:327/902 of query aligns to 9:264/444 of 1c9uA
Sites not aligning to the query:
1cruA Soluble quinoprotein glucose dehydrogenase from acinetobacter calcoaceticus in complex with pqq and methylhydrazine (see paper)
25% identity, 32% coverage: 35:327/902 of query aligns to 9:268/448 of 1cruA
Sites not aligning to the query:
P13650 Quinoprotein glucose dehydrogenase B; Glucose dehydrogenase B [pyrroloquinoline-quinone]; Soluble glucose dehydrogenase; s-GDH; EC 1.1.5.2 from Acinetobacter calcoaceticus (see paper)
26% identity, 35% coverage: 8:327/902 of query aligns to 11:294/478 of P13650
Sites not aligning to the query:
5minB Apo form of the soluble pqq-dependent glucose dehydrogenase from acinetobacter calcoaceticus
25% identity, 32% coverage: 35:327/902 of query aligns to 9:270/453 of 5minB
Sites not aligning to the query:
>CA265_RS11590 FitnessBrowser__Pedo557:CA265_RS11590
MKTTFTLLLSALAFVFISATTLNKNIYESKAFEFFTKSKIDTPDQDRFVKVTLAQGEFTE
PTEMTILPNLDILVAQRRGEVLIYKNQTKKIKEAGKLDVYFKTSVPDVNAEEGLLGMAAD
PKFAVNQYIYLFYSPFDKSVNRLSRFKLINDQIVKESEKIILEFYSQREICCHTGGSIAF
GSDNLLYVSTGDNSTPFDVPKQQYVNKGYAPLDNRKGLEQYDARRSAGNTNDLRGKILRI
KVNEDGTYSIPDGNLFSKNDPKARPEIYVMGNRNPYRISVDQKNNFLYWGEVGPDASNDD
ALRGPRGYDEVNQARKAGNFGWPLFVGNNYAYKAYDYTNGANGNAFDPESPINNSPNNTG
LEKLPAAQPAFIWYPYGASKEFPQVGAGGRTAMAGPVYYATANSPYPAYYNGKLIIYEWV
RGWVKAVTMNAQGDYLSMEPFMAKVSLAAPIDMELGPDGKIYVLEYGKGWFTKNPDAAIT
RIDYLKGNRPPTVEDLNIAKTSGLLPYKMTATVTAKDPDGDALTYIWNLGKGVTKTTTIP
TIQHTYTKAGEYPLSVTVMDKSKASAKSQVIPVFAGNEHPNVNIDLAGNKSFYFPNKPVD
YKVLVSDKGAKVNNSRIYISNTYTEGSDLAGAQLGHQQAAQTLVGKTIMLKSDCSTCHKE
AAVSIGPAFNKIAAKYKNDSKAVDYLASKVIAGSHGVWGEVPMPAHTTMKEAEVKKITEW
IMTLGNKEAVKASLPTSGKIVPPAATDKKKSVLTLKATYTDAGAAGLKPLTTTNLINLKS
SVIDADDIKDFGGFQRKDVFGGEKLVLTKDNGWLALKNIDLTGISGFGFSFLNLDPGADG
EIEIRLDDSKGIMIGKSTFRKSIPINMLSDGKFHSIYFVFKELKTSDKKNRPIIQSITVE
PK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory