SitesBLAST
Comparing CA265_RS11605 FitnessBrowser__Pedo557:CA265_RS11605 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 12 hits to proteins with known functional sites (download)
5ur2B Crystal structure of proline utilization a (puta) from bdellovibrio bacteriovorus inactivated by n-propargylglycine (see paper)
28% identity, 53% coverage: 165:373/394 of query aligns to 194:401/959 of 5ur2B
- binding N-propargylglycine-modified flavin adenine dinucleotide: D215 (= D186), M216 (≠ A187), Q249 (= Q219), V278 (= V248), K279 (≠ R249), G280 (= G250), A281 (= A251), W283 (≠ M253), Y300 (≠ Q270), T301 (≠ P271), N302 (≠ D272), K303 (= K273), S306 (= S276), A329 (≠ G299), S330 (≠ T300), H331 (= H301), N332 (= N302), Q356 (≠ A328), M357 (≠ Q329), L358 (= L330), Y379 (= Y351), E398 (= E370)
Sites not aligning to the query:
4nmfA Crystal structure of proline utilization a (puta) from geobacter sulfurreducens pca inactivated by n-propargylglycine and complexed with menadione bisulfite (see paper)
23% identity, 82% coverage: 69:390/394 of query aligns to 95:423/973 of 4nmfA
- binding (2R)-2-methyl-1,4-dioxo-1,2,3,4-tetrahydronaphthalene-2-sulfonic acid: K181 (≠ T137), Y287 (= Y252), Y384 (= Y351), Y396 (= Y363), R399 (= R366), R400 (= R367)
- binding N-propargylglycine-modified flavin adenine dinucleotide: K181 (≠ T137), D222 (= D186), M223 (≠ A187), V252 (vs. gap), Q254 (= Q219), R281 (≠ K246), V283 (= V248), K284 (≠ R249), G285 (= G250), A286 (= A251), W288 (≠ M253), W305 (≠ Q270), T306 (≠ P271), I307 (≠ D272), K308 (= K273), S311 (= S276), A334 (≠ G299), S335 (≠ T300), H336 (= H301), N337 (= N302), Q361 (≠ A328), V362 (≠ Q329), L363 (= L330), Y384 (= Y351), E403 (= E370), E408 (≠ A375), F410 (≠ Q377)
Sites not aligning to the query:
4nmaA Crystal structure of proline utilization a (puta) from geobacter sulfurreducens pca in complex with l-tetrahydro-2-furoic acid (see paper)
24% identity, 82% coverage: 69:390/394 of query aligns to 99:430/977 of 4nmaA
- binding flavin-adenine dinucleotide: D226 (= D186), M227 (≠ A187), Q258 (= Q219), R285 (≠ K246), V287 (= V248), K288 (≠ R249), G289 (= G250), A290 (= A251), Y291 (= Y252), W292 (≠ M253), W309 (≠ Q270), T310 (≠ P271), I311 (≠ D272), K312 (= K273), S315 (= S276), A338 (≠ G299), S339 (≠ T300), H340 (= H301), N341 (= N302), Q365 (≠ A328), L367 (= L330), E407 (= E370), S413 (= S373), F414 (≠ V374)
- binding tetrahydrofuran-2-carboxylic acid: K185 (≠ T137), Y388 (= Y351), Y400 (= Y363), R403 (= R366), R404 (= R367)
Sites not aligning to the query:
4nmfB Crystal structure of proline utilization a (puta) from geobacter sulfurreducens pca inactivated by n-propargylglycine and complexed with menadione bisulfite (see paper)
24% identity, 82% coverage: 69:390/394 of query aligns to 98:429/979 of 4nmfB
- binding (2R)-2-methyl-1,4-dioxo-1,2,3,4-tetrahydronaphthalene-2-sulfonic acid: K184 (≠ T137), Y290 (= Y252), Y387 (= Y351), Y399 (= Y363), R402 (= R366), R403 (= R367)
- binding (2S)-2-methyl-1,4-dioxo-1,2,3,4-tetrahydronaphthalene-2-sulfonic acid: K184 (≠ T137), L366 (= L330), Y399 (= Y363), R402 (= R366)
- binding N-propargylglycine-modified flavin adenine dinucleotide: K184 (≠ T137), D225 (= D186), M226 (≠ A187), V255 (vs. gap), Q257 (= Q219), R284 (≠ K246), V286 (= V248), K287 (≠ R249), G288 (= G250), A289 (= A251), W291 (≠ M253), W308 (≠ Q270), T309 (≠ P271), I310 (≠ D272), K311 (= K273), S314 (= S276), A337 (≠ G299), S338 (≠ T300), H339 (= H301), N340 (= N302), Q364 (≠ A328), L366 (= L330), Y387 (= Y351), E406 (= E370), E411 (vs. gap), S412 (= S373), F413 (≠ V374)
Sites not aligning to the query:
4nmdA Crystal structure of proline utilization a (puta) from geobacter sulfurreducens pca reduced with dithionite (see paper)
24% identity, 82% coverage: 69:390/394 of query aligns to 99:430/979 of 4nmdA
- binding dihydroflavine-adenine dinucleotide: D226 (= D186), M227 (≠ A187), V256 (vs. gap), Q258 (= Q219), R285 (≠ K246), V287 (= V248), K288 (≠ R249), G289 (= G250), A290 (= A251), W292 (≠ M253), W309 (≠ Q270), T310 (≠ P271), I311 (≠ D272), K312 (= K273), S315 (= S276), A338 (≠ G299), S339 (≠ T300), H340 (= H301), N341 (= N302), Q365 (≠ A328), V366 (≠ Q329), L367 (= L330), Y388 (= Y351), F414 (≠ V374)
Sites not aligning to the query:
7na0A Structure of geobacter sulfurreducens proline utilization a (puta) variant a206w (see paper)
24% identity, 82% coverage: 69:390/394 of query aligns to 99:430/981 of 7na0A
- binding flavin-adenine dinucleotide: D226 (= D186), M227 (≠ A187), V256 (vs. gap), Q258 (= Q219), R285 (≠ K246), V287 (= V248), K288 (≠ R249), G289 (= G250), A290 (= A251), Y291 (= Y252), W292 (≠ M253), W309 (≠ Q270), T310 (≠ P271), I311 (≠ D272), K312 (= K273), S315 (= S276), A338 (≠ G299), S339 (≠ T300), H340 (= H301), N341 (= N302), L367 (= L330), Y388 (= Y351), E407 (= E370), S413 (= S373), F414 (≠ V374)
4nmeA Crystal structure of proline utilization a (puta) from geobacter sulfurreducens pca inactivated by n-propargylglycine (see paper)
24% identity, 82% coverage: 69:390/394 of query aligns to 97:425/972 of 4nmeA
- binding N-propargylglycine-modified flavin adenine dinucleotide: K183 (≠ T137), D224 (= D186), M225 (≠ A187), V254 (vs. gap), Q256 (= Q219), R283 (≠ K246), V285 (= V248), K286 (≠ R249), G287 (= G250), A288 (= A251), W290 (≠ M253), W307 (≠ Q270), T308 (≠ P271), I309 (≠ D272), K310 (= K273), S313 (= S276), A336 (≠ G299), S337 (≠ T300), H338 (= H301), N339 (= N302), Q363 (≠ A328), L365 (= L330), Y383 (= Y351), E402 (= E370), F409 (≠ V374)
Sites not aligning to the query:
4nmcA Crystal structure of oxidized proline utilization a (puta) from geobacter sulfurreducens pca complexed with zwittergent 3-12 (see paper)
23% identity, 82% coverage: 69:393/394 of query aligns to 88:409/941 of 4nmcA
- binding flavin-adenine dinucleotide: D215 (= D186), M216 (≠ A187), V245 (vs. gap), Q247 (= Q219), R274 (≠ K246), V276 (= V248), K277 (≠ R249), G278 (= G250), A279 (= A251), W281 (≠ M253), W298 (≠ Q270), T299 (≠ P271), I300 (≠ D272), K301 (= K273), S304 (= S276), A327 (≠ G299), S328 (≠ T300), H329 (= H301), N330 (= N302), L356 (= L330), Y377 (= Y351)
Sites not aligning to the query:
Q72IB8 Proline dehydrogenase; PRODH; Proline oxidase; TtPRODH; EC 1.5.5.2 from Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) (see 2 papers)
26% identity, 77% coverage: 67:371/394 of query aligns to 31:293/307 of Q72IB8
2g37B Structure of thermus thermophilus l-proline dehydrogenase (see paper)
26% identity, 77% coverage: 67:371/394 of query aligns to 37:299/300 of 2g37B
- binding flavin-adenine dinucleotide: D139 (= D186), M140 (≠ A187), V167 (= V214), R190 (≠ K246), V192 (= V248), K193 (≠ R249), G194 (= G250), A195 (= A251), A231 (≠ G299), T232 (= T300), H233 (= H301), D234 (≠ N302), L260 (= L330), V263 (≠ M333), Y281 (= Y351)
6bsnA Structure of proline utilization a (puta) with proline bound in remote sites (see paper)
30% identity, 35% coverage: 235:371/394 of query aligns to 319:452/973 of 6bsnA
- binding dihydroflavine-adenine dinucleotide: R330 (≠ K246), V332 (= V248), K333 (≠ R249), G334 (= G250), A335 (= A251), Y336 (= Y252), W337 (≠ M253), F355 (≠ Q270), T356 (≠ P271), R357 (≠ D272), K358 (= K273), T361 (≠ S276), A384 (≠ G299), T385 (= T300), H386 (= H301), N387 (= N302), Y432 (= Y351)
Sites not aligning to the query:
- active site: 643, 743, 777, 951
- binding dihydroflavine-adenine dinucleotide: 269, 270, 303, 457, 458
- binding proline: 630, 642, 644, 718, 776, 778, 871, 930, 931, 932, 939, 958, 959, 961
3hazA Crystal structure of bifunctional proline utilization a (puta) protein (see paper)
30% identity, 35% coverage: 235:371/394 of query aligns to 322:455/983 of 3hazA
- binding flavin-adenine dinucleotide: R333 (≠ K246), V335 (= V248), K336 (≠ R249), G337 (= G250), A338 (= A251), Y339 (= Y252), W340 (≠ M253), F358 (≠ Q270), T359 (≠ P271), R360 (≠ D272), K361 (= K273), T364 (≠ S276), A387 (≠ G299), T388 (= T300), H389 (= H301), N390 (= N302), Y435 (= Y351)
Sites not aligning to the query:
- active site: 652, 675, 752, 786, 878, 960
- binding flavin-adenine dinucleotide: 272, 273, 306, 460, 461
- binding nicotinamide-adenine-dinucleotide: 648, 649, 650, 651, 652, 657, 675, 676, 677, 708, 711, 712, 726, 727, 728, 731, 735, 752, 753, 786, 878, 880, 948
Query Sequence
>CA265_RS11605 FitnessBrowser__Pedo557:CA265_RS11605
MDLSPNKQPNFDNTEVAFRQKTNGELKKAYWLFKMIGSNFLTKVGPAITNFFLNIGLPIQ
GAIKATIFQQFCGGETIAECDKAIEQLHKGGVGTILDYSVEGEEEEQVFDETCAEIIRTI
MRADGDVKIPITVFKITGIGRFALLQKLDAKETLNASEKAEYEKVKQRCEKICQTAFDKG
VPIMIDAEETWIQDTIDELALDMMRKFNRERIIVYNTYQMYRHDKLADMKADHLIAKADG
FILGVKMVRGAYMEKERKRAAEMGYPSPIQPDKAASDRDYNESLRYCVDHIEEIAIVAGT
HNEDSSRLLTYLLEEKNITHNHPHVYFAQLLGMSDNLSFNLADSNYNVAKYVPYGPIKAV
MPYLFRRAQENTSVAGQTGRELGLIERELKRRKL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory