SitesBLAST
Comparing CA265_RS11615 FitnessBrowser__Pedo557:CA265_RS11615 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P56081 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 from Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) (see paper)
38% identity, 91% coverage: 30:350/352 of query aligns to 27:343/343 of P56081
Q9KNV2 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
35% identity, 96% coverage: 15:352/352 of query aligns to 19:361/361 of Q9KNV2
3okfA 2.5 angstrom resolution crystal structure of 3-dehydroquinate synthase (arob) from vibrio cholerae
36% identity, 96% coverage: 15:352/352 of query aligns to 20:360/360 of 3okfA
- active site: R120 (= R114), K142 (= K136), E184 (= E178), K226 (= K214), R238 (= R228), N242 (= N232), H245 (= H235), H249 (= H239), H262 (= H255)
- binding nicotinamide-adenine-dinucleotide: N42 (≠ D37), L48 (≠ I43), D71 (≠ A65), E73 (= E67), K76 (= K70), G104 (= G98), G105 (= G99), V106 (= V100), D109 (= D103), T129 (= T123), T130 (= T124), L132 (= L126), D136 (= D130), T172 (= T166), L173 (= L167), E177 (= E171)
U3KRF2 3-dehydroquinate synthase, chloroplastic; EC 4.2.3.4 from Actinidia chinensis var. chinensis (Chinese soft-hair kiwi) (see paper)
36% identity, 92% coverage: 9:333/352 of query aligns to 93:426/445 of U3KRF2
3zokA Structure of 3-dehydroquinate synthase from actinidia chinensis in complex with NAD (see paper)
36% identity, 92% coverage: 9:333/352 of query aligns to 13:346/365 of 3zokA
- active site: R122 (= R114), K144 (= K136), E186 (= E178), K228 (= K214), E238 (= E224), R242 (= R228), N246 (= N232), H249 (= H235), H253 (= H239), H266 (= H255)
- binding glycine: K144 (= K136), K228 (= K214), R242 (= R228)
- binding nicotinamide-adenine-dinucleotide: T44 (≠ H39), V45 (≠ T40), D73 (≠ A65), E75 (= E67), K78 (= K70), G106 (= G98), G107 (= G99), V108 (= V100), D111 (= D103), T131 (= T123), T132 (= T124), M134 (≠ L126), D138 (= D130), S139 (≠ A131), K144 (= K136), K153 (= K145), T174 (= T166), L175 (= L167), E179 (= E171), H266 (= H255)
Q5NFS1 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 from Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
36% identity, 95% coverage: 1:334/352 of query aligns to 7:344/359 of Q5NFS1
P9WPX9 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
36% identity, 85% coverage: 31:330/352 of query aligns to 39:340/362 of P9WPX9
3clhA Crystal structure of 3-dehydroquinate synthase (dhqs)from helicobacter pylori (see paper)
41% identity, 76% coverage: 30:298/352 of query aligns to 24:279/308 of 3clhA
- active site: R107 (= R114), K129 (= K136), E171 (= E178), K207 (= K214), R212 (= R228), N216 (= N232), H219 (= H235), H223 (= H239), H236 (= H255)
- binding nicotinamide-adenine-dinucleotide: I33 (≠ H39), V34 (≠ T40), H38 (≠ C44), S58 (≠ A65), E60 (= E67), K63 (= K70), G91 (= G98), G92 (= G99), V93 (= V100), D96 (= D103), T116 (= T123), T117 (= T124), L119 (= L126), D123 (= D130), A124 (= A131), K129 (= K136), N139 (= N146), T159 (= T166), L160 (= L167), E164 (= E171)
6hqvA Pentafunctional arom complex from chaetomium thermophilum (see paper)
34% identity, 91% coverage: 23:341/352 of query aligns to 28:376/1555 of 6hqvA
- active site: R123 (= R114), K145 (= K136), E187 (= E178), K243 (= K214), E253 (= E224), R257 (= R228), N261 (= N232), H264 (= H235), H268 (= H239), H280 (= H255)
- binding glutamic acid: D139 (= D130), K145 (= K136), E187 (= E178), K243 (= K214), R257 (= R228), H264 (= H235), H280 (= H255)
- binding nicotinamide-adenine-dinucleotide: D42 (= D37), N44 (≠ H39), L45 (≠ T40), E76 (= E67), K79 (= K70), G107 (= G98), G108 (= G99), V109 (= V100), D112 (= D103), T132 (= T123), T133 (= T124), L135 (= L126), D139 (= D130), S140 (≠ A131), K145 (= K136), K154 (= K145), T175 (= T166), L176 (= L167), P177 (= P168), E180 (= E171), H280 (= H255)
- binding zinc ion: E187 (= E178), H264 (= H235), H280 (= H255)
Sites not aligning to the query:
- binding (4S,5R)-4,5-dihydroxy-3-oxocyclohex-1-ene-1-carboxylic acid: 1060, 1062, 1181, 1224, 1232, 1242, 1243
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: 413, 562, 563, 874, 923, 924, 979, 1277, 1279, 1323, 1327, 1348, 1368, 1526
3qbeA Crystal structure of the 3-dehydroquinate synthase (arob) from mycobacterium tuberculosis
35% identity, 85% coverage: 31:330/352 of query aligns to 34:331/352 of 3qbeA
- active site: R117 (= R114), K139 (= K136), E181 (= E178), K223 (= K214), R233 (= R228), N237 (= N232), H240 (= H235), H244 (= H239), H256 (= H255)
- binding zinc ion: E181 (= E178), H240 (= H235), H256 (= H255)
5hvnA 3.0 angstrom crystal structure of 3-dehydroquinate synthase (arob) from francisella tularensis in complex with NAD.
36% identity, 95% coverage: 1:334/352 of query aligns to 10:339/354 of 5hvnA
- active site: R123 (= R114), K145 (= K136), E187 (= E178), K228 (= K214), R239 (= R228), N243 (= N232), H246 (= H235), H250 (= H239), H263 (= H255)
- binding nicotinamide-adenine-dinucleotide: N45 (≠ D37), L51 (≠ I43), D73 (≠ A65), E75 (= E67), K78 (= K70), G107 (= G98), G108 (= G99), V109 (= V100), D112 (= D103), T132 (= T123), T133 (= T124), L135 (= L126), D139 (= D130), K145 (= K136), F172 (= F163), T175 (= T166), L176 (= L167), E180 (= E171)
6c5cA Crystal structure of the 3-dehydroquinate synthase (dhqs) domain of aro1 from candida albicans sc5314 in complex with nadh (see paper)
36% identity, 81% coverage: 46:331/352 of query aligns to 52:367/385 of 6c5cA
- active site: R130 (= R114), K152 (= K136), E194 (= E178), K246 (= K214), E254 (= E224), R258 (= R228), N262 (= N232), H265 (= H235), H269 (= H239), H281 (= H255)
- binding nicotinamide-adenine-dinucleotide: E83 (= E67), K86 (= K70), G114 (= G98), G115 (= G99), V116 (= V100), D119 (= D103), T139 (= T123), T140 (= T124), D146 (= D130), S147 (≠ A131), F179 (= F163), T182 (= T166), L183 (= L167), Q187 (≠ E171)
Sites not aligning to the query:
5eksA Structure of 3-dehydroquinate synthase from acinetobacter baumannii in complex with NAD
40% identity, 71% coverage: 66:314/352 of query aligns to 72:320/355 of 5eksA
- active site: R120 (= R114), K142 (= K136), E184 (= E178), K226 (= K214), R237 (= R228), N241 (= N232), H244 (= H235), H248 (= H239), H261 (= H255)
- binding magnesium ion: E184 (= E178), H244 (= H235), H261 (= H255)
- binding nicotinamide-adenine-dinucleotide: E73 (= E67), K76 (= K70), G104 (= G98), G105 (= G99), V106 (= V100), D109 (= D103), T129 (= T123), T130 (= T124), D136 (= D130), S137 (≠ A131), K142 (= K136), T172 (= T166), L173 (= L167), E177 (= E171)
Sites not aligning to the query:
1xagA Crystal structure of staphlyococcus aureus 3-dehydroquinate synthase (dhqs) in complex with zn2+, NAD+ and carbaphosphonate (see paper)
33% identity, 86% coverage: 27:329/352 of query aligns to 29:330/353 of 1xagA
- active site: R115 (= R114), K136 (= K136), E178 (= E178), K221 (= K214), E231 (= E224), R235 (= R228), N239 (= N232), H242 (= H235), H246 (= H239), H256 (= H255)
- binding [1r-(1alpha,3beta,4alpha,5beta)]-5-(phosphonomethyl)-1,3,4-trihydroxycyclohexane-1-carboxylic acid: K136 (= K136), N146 (= N146), E178 (= E178), K221 (= K214), R235 (= R228), L238 (= L231), N239 (= N232), H242 (= H235), H246 (= H239), K314 (= K313)
- binding nicotinamide-adenine-dinucleotide: D39 (= D37), Y41 (≠ H39), V42 (≠ T40), Y45 (≠ I43), E68 (= E67), K71 (= K70), G99 (= G98), G100 (= G99), A101 (≠ V100), D104 (= D103), T124 (= T123), T125 (= T124), L127 (= L126), D130 (= D130), S131 (≠ A131), K136 (= K136), K145 (= K145), T166 (= T166), L167 (= L167), Q171 (≠ E171), H256 (= H255)
- binding zinc ion: E178 (= E178), H242 (= H235), H256 (= H255)
Q6GGU4 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 from Staphylococcus aureus (strain MRSA252) (see paper)
33% identity, 86% coverage: 27:329/352 of query aligns to 29:330/354 of Q6GGU4
3qbdA 3-dehydroquinate synthase (arob) from mycobacterium tuberculosis in complex with NAD
35% identity, 80% coverage: 31:311/352 of query aligns to 34:311/344 of 3qbdA
- active site: R117 (= R114), K139 (= K136), E181 (= E178), K223 (= K214), R232 (= R228), N236 (= N232), H239 (= H235), H243 (= H239), H255 (= H255)
- binding nicotinamide-adenine-dinucleotide: Q40 (≠ D37), D68 (≠ A65), A69 (≠ G66), E70 (= E67), K73 (= K70), G101 (= G98), G102 (= G99), A103 (≠ V100), D106 (= D103), T126 (= T123), T127 (= T124), L129 (= L126), A134 (= A131), T169 (= T166), L170 (= L167)
6llaB Crystal structure of providencia alcalifaciens 3-dehydroquinate synthase (dhqs) in complex with mg2+ and NAD (see paper)
34% identity, 90% coverage: 30:346/352 of query aligns to 36:358/363 of 6llaB
- active site: R121 (= R114), K143 (= K136), E185 (= E178), K227 (= K214), E237 (= E224), R242 (= R228), N246 (= N232), H249 (= H235), H253 (= H239), H266 (= H255)
- binding magnesium ion: E185 (= E178), H249 (= H235), H266 (= H255)
- binding nicotinamide-adenine-dinucleotide: L46 (≠ T40), D72 (≠ A65), E74 (= E67), K77 (= K70), G105 (= G98), G106 (= G99), V107 (= V100), D110 (= D103), T130 (= T123), T131 (= T124), L133 (= L126), D137 (= D130), K143 (= K136), T173 (= T166), L174 (= L167), E178 (= E171)
6lk2A Crystal structure of providencia alcalifaciens 3-dehydroquinate synthase (dhqs) in complex with mg2+, NAD and chlorogenic acid (see paper)
34% identity, 90% coverage: 30:346/352 of query aligns to 36:354/357 of 6lk2A
- active site: R121 (= R114), K143 (= K136), E185 (= E178), K227 (= K214), R238 (= R228), N242 (= N232), H245 (= H235), H249 (= H239), H262 (= H255)
- binding (1R,3R,4S,5R)-3-[3-[3,4-bis(oxidanyl)phenyl]propanoyloxy]-1,4,5-tris(oxidanyl)cyclohexane-1-carboxylic acid: D137 (= D130), E185 (= E178), K227 (= K214), R238 (= R228), N242 (= N232), H245 (= H235), T246 (= T236), H249 (= H239), H262 (= H255)
- binding magnesium ion: E185 (= E178), H245 (= H235), H262 (= H255)
- binding nicotinamide-adenine-dinucleotide: L46 (≠ T40), D72 (≠ A65), E74 (= E67), K77 (= K70), G105 (= G98), G106 (= G99), V107 (= V100), D110 (= D103), T130 (= T123), T131 (= T124), L133 (= L126), D137 (= D130), S138 (≠ A131), C170 (≠ F163), T173 (= T166), L174 (= L167), P175 (= P168), E178 (= E171)
1dqsA Crystal structure of dehydroquinate synthase (dhqs) complexed with carbaphosphonate, NAD+ and zn2+ (see paper)
36% identity, 71% coverage: 79:329/352 of query aligns to 92:362/381 of 1dqsA
- active site: R127 (= R114), K149 (= K136), E191 (= E178), K240 (vs. gap), E250 (= E224), R254 (= R228), N258 (= N232), H261 (= H235), H265 (= H239), H277 (= H255)
- binding [1r-(1alpha,3beta,4alpha,5beta)]-5-(phosphonomethyl)-1,3,4-trihydroxycyclohexane-1-carboxylic acid: D143 (= D130), K149 (= K136), N159 (= N146), E191 (= E178), K240 (vs. gap), R254 (= R228), L257 (= L231), N258 (= N232), H261 (= H235), H265 (= H239), H277 (= H255), K346 (= K313)
- binding nicotinamide-adenine-dinucleotide: G111 (= G98), G112 (= G99), V113 (= V100), D116 (= D103), T136 (= T123), T137 (= T124), L139 (= L126), D143 (= D130), S144 (≠ A131), K158 (= K145), T179 (= T166), P181 (= P168), E184 (= E171), H277 (= H255)
- binding zinc ion: E191 (= E178), H261 (= H235), H277 (= H255)
Sites not aligning to the query:
1nvbB Crystal structure of 3-dehydroquinate synthase (dhqs) in complex with zn2+ and carbaphosphonate (see paper)
36% identity, 71% coverage: 79:329/352 of query aligns to 93:370/391 of 1nvbB
- active site: R128 (= R114), K150 (= K136), E192 (= E178), K248 (= K214), E258 (= E224), R262 (= R228), N266 (= N232), H269 (= H235), H273 (= H239), H285 (= H255)
- binding [1r-(1alpha,3beta,4alpha,5beta)]-5-(phosphonomethyl)-1,3,4-trihydroxycyclohexane-1-carboxylic acid: D144 (= D130), K150 (= K136), N160 (= N146), E192 (= E178), K248 (= K214), R262 (= R228), L265 (= L231), N266 (= N232), H269 (= H235), H273 (= H239), K354 (= K313)
- binding zinc ion: E192 (= E178), H269 (= H235), H285 (= H255)
Query Sequence
>CA265_RS11615 FitnessBrowser__Pedo557:CA265_RS11615
MKPLTSAGHTLYFESSLAALKTLLESNKYSKVFVLADEHTSEICLPLFQSLLDDFSEFDL
IETSAGEENKNIDFCIGIWKTLLDFEADRKSLMINLGGGVITDMGGFIASTYKRGIDFIN
VPTTLLSQVDASVGGKTGIDIDNVKNMVGTFTLPQMVFIETAFLKTLPQRELLSGFAEMI
KHGLIYDKPYYEKLKESNYLTPSAEDIYRSVEIKNEVVTIDPHEKNLRKILNFGHTIGHA
VEGYSLANDENPLTHGEAIAIGFVCEAALSIKNSTLTQAELKDISEYILSLYPKYHIKKE
SFDTLLELMQSDKKNEDGNILFSLLETTGKCTFNCRVSTADILSSLDYYNSL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory