Comparing CA265_RS11635 FitnessBrowser__Pedo557:CA265_RS11635 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 12 hits to proteins with known functional sites (download)
1zcoB Crystal structure of pyrococcus furiosus 3-deoxy-d-arabino- heptulosonate 7-phosphate synthase (see paper)
36% identity, 63% coverage: 22:259/379 of query aligns to 26:255/262 of 1zcoB
1zcoA Crystal structure of pyrococcus furiosus 3-deoxy-d-arabino- heptulosonate 7-phosphate synthase (see paper)
36% identity, 63% coverage: 22:259/379 of query aligns to 26:255/262 of 1zcoA
4c1kA Crystal structure of pyrococcus furiosus 3-deoxy-d-arabino- heptulosonate 7-phosphate synthase (see paper)
35% identity, 63% coverage: 22:259/379 of query aligns to 26:255/262 of 4c1kA
4grsA Crystal structure of a chimeric dah7ps (see paper)
35% identity, 64% coverage: 17:259/379 of query aligns to 92:326/333 of 4grsA
Sites not aligning to the query:
3pg9A Thermotoga maritima dah7p synthase in complex with inhibitor (see paper)
35% identity, 64% coverage: 17:259/379 of query aligns to 92:326/338 of 3pg9A
Sites not aligning to the query:
1rzmA Crystal structure of 3-deoxy-d-arabino-heptulosonate-7-phosphate synthase (dahps) from thermotoga maritima complexed with cd2+, pep and e4p (see paper)
35% identity, 64% coverage: 17:259/379 of query aligns to 92:326/338 of 1rzmA
3tfcA 1.95 angstrom crystal structure of a bifunctional 3-deoxy-7- phosphoheptulonate synthase/chorismate mutase (aroa) from listeria monocytogenes egd-e in complex with phosphoenolpyruvate (see paper)
35% identity, 61% coverage: 17:247/379 of query aligns to 103:325/343 of 3tfcA
3nvtA 1.95 angstrom crystal structure of a bifunctional 3-deoxy-7- phosphoheptulonate synthase/chorismate mutase (aroa) from listeria monocytogenes egd-e (see paper)
35% identity, 61% coverage: 17:247/379 of query aligns to 104:326/345 of 3nvtA
5j6fA Crystal structure of dah7ps-cm complex from geobacillus sp. With prephenate (see paper)
31% identity, 66% coverage: 11:259/379 of query aligns to 102:348/352 of 5j6fA
Sites not aligning to the query:
P39912 Protein AroA(G); EC 2.5.1.54; EC 5.4.99.5 from Bacillus subtilis (strain 168) (see paper)
35% identity, 60% coverage: 22:247/379 of query aligns to 121:338/358 of P39912
Sites not aligning to the query:
1vs1D Crystal structure of 3-deoxy-d-arabino-heptulosonate-7-phosphate synthase (dahp synthase) from aeropyrum pernix in complex with mn2+ and pep
37% identity, 63% coverage: 22:259/379 of query aligns to 36:265/271 of 1vs1D
3fyoD Crystal structure of the triple mutant (n23c/d247e/p249a) of 3-deoxy- d-manno-octulosonate 8-phosphate synthase (kdo8ps) from neisseria meningitidis (see paper)
27% identity, 57% coverage: 17:233/379 of query aligns to 12:228/261 of 3fyoD
>CA265_RS11635 FitnessBrowser__Pedo557:CA265_RS11635
MKLNLNIQSLNTWLNVNNEPLIISGPCSAETEEQLLTTAHLLAATGKVSVLRAGIWKPRT
RPGEFEGIGSIGLEWLKRAKAETGLPTAVEVANAKHVEEALAAGVDILWIGARSTVNPFT
VQEIADALKGHDVPVLIKNPVNPDLQLWIGAIERINGAGITKIGAIHRGFSSFEKSSFRN
EPMWELAIQLKTLCPELPIINDPSHICGNRELIPYISQKALDLDMQGLMIESHVDPSVAW
TDAKQQVTPAALAELVDRLTVREPEAPNEAFADKLADLRKSIDKIDDVLLQKLGERMAIV
EKIGEFKRDNQVTILQVNRWDAIIKKGHAFAKALKLDLNFTEKFLELVHGESIRKQTEIM
NAGKAEQGIAAEQHTEVKA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory