Comparing CA265_RS11675 FitnessBrowser__Pedo557:CA265_RS11675 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1xi9C Alanine aminotransferase from pyrococcus furiosus pfu-1397077-001
33% identity, 95% coverage: 16:393/399 of query aligns to 13:392/393 of 1xi9C
P58350 Aspartate aminotransferase; AAT; AspAT; Putative 2-aminoadipate transaminase; Transaminase A; EC 2.6.1.1; EC 2.6.1.39 from Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
29% identity, 97% coverage: 3:390/399 of query aligns to 17:405/410 of P58350
1gdeA Crystal structure of pyrococcus protein a-1 e-form (see paper)
30% identity, 95% coverage: 13:393/399 of query aligns to 11:384/388 of 1gdeA
1gd9A Crystall structure of pyrococcus protein-a1 (see paper)
30% identity, 95% coverage: 13:393/399 of query aligns to 11:384/388 of 1gd9A
1o4sB Crystal structure of aspartate aminotransferase (tm1255) from thermotoga maritima at 1.90 a resolution (see paper)
30% identity, 96% coverage: 4:388/399 of query aligns to 10:379/384 of 1o4sB
1b5oA Thermus thermophilus aspartate aminotransferase single mutant 1 (see paper)
29% identity, 96% coverage: 1:385/399 of query aligns to 1:376/382 of 1b5oA
6f35A Crystal structure of the aspartate aminotranferase from rhizobium meliloti (see paper)
29% identity, 97% coverage: 3:390/399 of query aligns to 7:395/400 of 6f35A
1gc4A Thermus thermophilus aspartate aminotransferase tetra mutant 2 complexed with aspartate (see paper)
29% identity, 96% coverage: 1:385/399 of query aligns to 1:376/382 of 1gc4A
1gc3A Thermus thermophilus aspartate aminotransferase tetra mutant 2 complexed with tryptophan (see paper)
29% identity, 96% coverage: 1:385/399 of query aligns to 1:376/382 of 1gc3A
1bkgA Aspartate aminotransferase from thermus thermophilus with maleate (see paper)
29% identity, 96% coverage: 1:385/399 of query aligns to 1:376/382 of 1bkgA
1bjwA Aspartate aminotransferase from thermus thermophilus (see paper)
29% identity, 96% coverage: 1:385/399 of query aligns to 1:376/382 of 1bjwA
Q56232 Aspartate/prephenate aminotransferase; AspAT / PAT; Transaminase A; EC 2.6.1.1; EC 2.6.1.78 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see 3 papers)
29% identity, 96% coverage: 1:385/399 of query aligns to 1:376/385 of Q56232
Q02635 Aspartate/prephenate aminotransferase; AspAT / PAT; Transaminase A; EC 2.6.1.1; EC 2.6.1.79 from Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
30% identity, 75% coverage: 23:323/399 of query aligns to 23:326/400 of Q02635
Sites not aligning to the query:
6f77A Crystal structure of the prephenate aminotransferase from rhizobium meliloti (see paper)
30% identity, 75% coverage: 23:323/399 of query aligns to 22:325/399 of 6f77A
5wmhA Arabidopsis thaliana prephenate aminotransferase (see paper)
30% identity, 94% coverage: 19:392/399 of query aligns to 17:397/399 of 5wmhA
5wmiA Arabidopsis thaliana prephenate aminotransferase mutant- t84v (see paper)
31% identity, 91% coverage: 29:392/399 of query aligns to 27:397/402 of 5wmiA
Sites not aligning to the query:
5wmlA Arabidopsis thaliana prephenate aminotransferase mutant- k306a (see paper)
30% identity, 94% coverage: 19:392/399 of query aligns to 18:398/404 of 5wmlA
Sites not aligning to the query:
Q58097 (5-formylfuran-3-yl)methyl phosphate transaminase; 4-HFC-P:alanine aminotransferase; EC 2.6.1.108 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
29% identity, 98% coverage: 4:393/399 of query aligns to 2:370/370 of Q58097
1v2fA Crystal structure of t.Th hb8 glutamine aminotransferase complex with 3-phenylpropionate (see paper)
28% identity, 93% coverage: 18:387/399 of query aligns to 2:364/368 of 1v2fA
1v2eA Crystal structure of t.Th hb8 glutamine aminotransferase complex with a-keto-g-methylthiobutyrate (see paper)
28% identity, 93% coverage: 18:387/399 of query aligns to 2:364/368 of 1v2eA
>CA265_RS11675 FitnessBrowser__Pedo557:CA265_RS11675
MPKISQKGVQMPASPIRKLTPFADQAKKDGKKVFHLNIGQPDIETPEGMLNAIKNIDFNV
WAYTPSEGTLAYRLKLTEYYNKLGYNITPENILVTVGGSEAITIAMQTCVNEGDEIIIPE
PFYANYNGFACMSNVVVKPILSYIENGFALPPIAEFEKLITEKTKAIIICNPNNPTGYLY
SRAELEALKTLCVKYDLFLFSDEAYREFCYDGREFISPMHLDGLDENVVIMDTVSKRYSA
CGARLGCLITKNKEVIASGLKFAQARLSPGMVEQIAGAAAVDTPDSYFEKVNTEYTLRRD
TLVGRLNQIEGVFCPNPGGAFYVVAKFPIDDADQFCQWILEDFNHNNQTVMMAPATGFYS
TPGSGKNEVRMAYVLNTDDLNAAMDCLEVALQQYPGRTV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory