SitesBLAST
Comparing CA265_RS12005 CA265_RS12005 glutathione-dependent formaldehyde dehydrogenase to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4cpdA Alcohol dehydrogenase tadh from thermus sp. Atn1
35% identity, 100% coverage: 1:384/385 of query aligns to 1:346/346 of 4cpdA
- active site: C38 (= C38), G39 (= G39), S40 (= S40), H43 (= H43), H59 (= H59), E60 (= E60), C89 (= C89), C92 (= C92), C95 (= C95), C103 (= C103), G107 (≠ N107), D152 (= D169), T156 (= T173), K340 (≠ C378)
- binding nicotinamide-adenine-dinucleotide: G39 (= G39), S40 (= S40), T156 (= T173), G178 (= G195), P179 (= P196), V180 (= V197), D200 (= D217), R201 (≠ P218), R205 (= R222), A243 (= A261), V244 (= V262), V266 (≠ M304), V268 (= V306), L292 (≠ Q330), A293 (= A331), F333 (= F371)
- binding zinc ion: C38 (= C38), H59 (= H59), C89 (= C89), C92 (= C92), C95 (= C95), C103 (= C103), D152 (= D169)
5ylnA Zinc dependent alcohol dehydrogenase 2 from streptococcus pneumonia - apo form
32% identity, 100% coverage: 1:384/385 of query aligns to 5:342/348 of 5ylnA
4jlwA Crystal structure of formaldehyde dehydrogenase from pseudomonas aeruginosa (see paper)
33% identity, 96% coverage: 2:372/385 of query aligns to 3:379/395 of 4jlwA
- binding nicotinamide-adenine-dinucleotide: C45 (= C38), G46 (= G39), S47 (= S40), H50 (= H43), D168 (= D169), T172 (= T173), G194 (= G195), P195 (= P196), V196 (= V197), D216 (= D217), R221 (= R222), V261 (= V262), R266 (≠ T277), H268 (= H279), V281 (= V287), P298 (≠ M304), L300 (≠ V306), Q336 (= Q330), T337 (≠ A331)
- binding zinc ion: C45 (= C38), H66 (= H59), C96 (= C89), C99 (= C92), C102 (= C95), C110 (= C103), D168 (= D169)
1kolA Crystal structure of formaldehyde dehydrogenase (see paper)
32% identity, 96% coverage: 2:372/385 of query aligns to 3:379/396 of 1kolA
- active site: C45 (= C38), G46 (= G39), S47 (= S40), H50 (= H43), H66 (= H59), E67 (= E60), C96 (= C89), C99 (= C92), C102 (= C95), C110 (= C103), N114 (= N107), D168 (= D169), T172 (= T173)
- binding nicotinamide-adenine-dinucleotide: C45 (= C38), G46 (= G39), S47 (= S40), H50 (= H43), F92 (= F85), D168 (= D169), T172 (= T173), G192 (= G193), G194 (= G195), P195 (= P196), V196 (= V197), D216 (= D217), L217 (≠ P218), R221 (= R222), A260 (= A261), V261 (= V262), R266 (≠ E267), H268 (≠ S269), V281 (= V287), P298 (≠ M304), L300 (≠ V306), Q336 (= Q330), T337 (≠ A331)
- binding zinc ion: C45 (= C38), H66 (= H59), C96 (= C89), C99 (= C92), C102 (= C95), C110 (= C103), D168 (= D169)
Sites not aligning to the query:
P46154 Glutathione-independent formaldehyde dehydrogenase; FALDH; FDH; Formaldehyde dismutase; EC 1.2.1.46; EC 1.2.98.1 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see paper)
31% identity, 96% coverage: 2:372/385 of query aligns to 5:381/399 of P46154
2dphA Crystal structure of formaldehyde dismutase
34% identity, 96% coverage: 2:372/385 of query aligns to 4:380/398 of 2dphA
- active site: C45 (= C38), G46 (= G39), S47 (= S40), H50 (= H43), H66 (= H59), E67 (= E60), C96 (= C89), C99 (= C92), C102 (= C95), C110 (= C103), L114 (≠ F108), S168 (≠ T168), D169 (= D169), P172 (= P172)
- binding nicotinamide-adenine-dinucleotide: C45 (= C38), G46 (= G39), S47 (= S40), H50 (= H43), F92 (= F85), D169 (= D169), T173 (= T173), A192 (≠ F192), G193 (= G193), G195 (= G195), P196 (= P196), V197 (= V197), G216 (≠ I216), D217 (= D217), Q218 (vs. gap), R222 (≠ D220), L236 (≠ I234), V262 (= V262), H267 (≠ R268), P298 (≠ M304), G299 (= G305), I300 (≠ V306), A337 (= A331)
- binding zinc ion: C45 (= C38), H66 (= H59), C96 (= C89), C99 (= C92), C102 (= C95), C110 (= C103), D169 (= D169)
Sites not aligning to the query:
Q52078 Formaldehyde dismutase; EC 1.2.98.1 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see paper)
34% identity, 96% coverage: 2:372/385 of query aligns to 5:381/399 of Q52078
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2:399 modified: mature protein, Formaldehyde dismutase
O58389 L-threonine 3-dehydrogenase; L-ThrDH; TDH; L-threonine dehydrogenase; EC 1.1.1.103 from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 2 papers)
31% identity, 98% coverage: 1:376/385 of query aligns to 5:330/348 of O58389
- C42 (= C38) binding
- T44 (≠ S40) mutation to A: Total loss of enzymatic activity.
- H67 (= H59) binding
- E68 (= E60) binding
- C97 (= C89) binding
- C100 (= C92) binding
- C103 (= C95) binding
- C111 (= C103) binding
- E152 (≠ A164) mutation E->A,Q: Almost complete loss of enzymatic activity.; mutation to C: 120-fold decrease in catalytic efficiency.; mutation to D: Shows 3-fold higher turnover rate and reduced affinities toward L-threonine and NAD(+), compared to wild-type.; mutation to K: Total loss of enzymatic activity.
- L179 (≠ V197) binding
- E199 (≠ D217) binding ; mutation to A: Large decrease in affinity for NAD(+).
- R204 (= R222) binding ; mutation to A: Large decrease in affinity for NAD(+).
- LGL 266:268 (≠ MGV 304:306) binding
- IT 291:292 (= IT 324:325) binding
- R294 (≠ K327) mutation to A: 4000-fold decrease in catalytic efficiency.
2dfvA Hyperthermophilic threonine dehydrogenase from pyrococcus horikoshii (see paper)
31% identity, 98% coverage: 1:376/385 of query aligns to 3:328/346 of 2dfvA
- active site: C40 (= C38), G41 (= G39), T42 (≠ S40), H45 (= H43), H65 (= H59), E66 (= E60), C95 (= C89), C98 (= C92), C101 (= C95), C109 (= C103), K113 (= K109), P151 (= P172), A155 (= A177)
- binding nicotinamide-adenine-dinucleotide: G175 (= G195), P176 (= P196), L177 (≠ V197), E197 (≠ D217), P198 (= P218), R202 (= R222), F241 (≠ A261), S242 (≠ K282), A244 (≠ S284), L264 (≠ M304), G265 (= G305), L266 (≠ V306), I289 (= I324), T290 (= T325)
- binding zinc ion: C95 (= C89), C101 (= C95), C109 (= C103)
Sites not aligning to the query:
P25406 Alcohol dehydrogenase 1B; Alcohol dehydrogenase I-B; ADH IB; EC 1.1.1.1 from Saara hardwickii (Indian spiny-tailed lizard) (Uromastyx hardwickii) (see paper)
29% identity, 97% coverage: 2:373/385 of query aligns to 10:365/375 of P25406
Sites not aligning to the query:
- 1 modified: N-acetylserine
P80512 Alcohol dehydrogenase 1; EC 1.1.1.1 from Naja naja (Indian cobra) (see paper)
29% identity, 97% coverage: 2:373/385 of query aligns to 10:365/375 of P80512
Sites not aligning to the query:
- 1 modified: N-acetylserine
P81601 Alcohol dehydrogenase class-3 chain L; Alcohol dehydrogenase class-III chain L; Glutathione-dependent formaldehyde dehydrogenase; FALDH; FDH; GSH-FDH; S-(hydroxymethyl)glutathione dehydrogenase; EC 1.1.1.1; EC 1.1.1.-; EC 1.1.1.284 from Gadus morhua (Atlantic cod) (see 2 papers)
30% identity, 90% coverage: 27:371/385 of query aligns to 35:363/375 of P81601
Sites not aligning to the query:
- 1 modified: N-acetylalanine
1u3tA Crystal structure of human alcohol dehydrogenase alpha-alpha isoform complexed with n-cyclopentyl-n-cyclobutylformamide determined to 2.5 angstrom resolution (see paper)
30% identity, 97% coverage: 2:373/385 of query aligns to 10:364/374 of 1u3tA
- active site: C46 (= C38), G47 (= G39), T48 (≠ S40), H51 (= H43), H67 (= H59), E68 (= E60), C97 (= C89), C100 (= C92), C103 (= C95), C111 (= C103), D115 (≠ N107), C174 (≠ D169), T178 (= T173)
- binding cyclobutyl(cyclopentyl)formamide: T48 (≠ S40), H67 (= H59), A93 (≠ P86), I94 (= I87), I318 (≠ V333)
- binding nicotinamide-adenine-dinucleotide: C46 (= C38), T48 (≠ S40), H51 (= H43), C174 (≠ D169), T178 (= T173), L200 (≠ S194), G201 (= G195), V203 (= V197), D223 (= D217), I224 (≠ P218), I269 (≠ V262), V292 (≠ M304), G293 (= G305), V294 (= V306)
- binding zinc ion: C46 (= C38), H67 (= H59), C97 (= C89), C100 (= C92), C103 (= C95), C111 (= C103), C174 (≠ D169)
Sites not aligning to the query:
1u3vA Crystal structure of human alcohol dehydrogenase beta-1-beta-1 isoform complexed with n-heptylformamide determined to 1.65 angstrom resolution (see paper)
30% identity, 97% coverage: 2:373/385 of query aligns to 10:364/374 of 1u3vA
- active site: C46 (= C38), R47 (≠ G39), T48 (≠ S40), H51 (= H43), H67 (= H59), E68 (= E60), C97 (= C89), C100 (= C92), C103 (= C95), C111 (= C103), D115 (≠ N107), C174 (≠ D169), T178 (= T173)
- binding heptylformamide: T48 (≠ S40), H67 (= H59), F93 (= F85), L116 (≠ F108), C174 (≠ D169)
- binding nicotinamide-adenine-dinucleotide: R47 (≠ G39), T48 (≠ S40), H51 (= H43), C174 (≠ D169), T178 (= T173), G199 (= G193), L200 (≠ S194), G201 (= G195), V203 (= V197), D223 (= D217), I224 (≠ P218), V268 (≠ A261), I269 (≠ V262), R271 (≠ F270), V292 (≠ M304), G293 (= G305), V294 (= V306), V318 (vs. gap)
- binding zinc ion: C46 (= C38), H67 (= H59), C97 (= C89), C100 (= C92), C103 (= C95), C111 (= C103), C174 (≠ D169)
Sites not aligning to the query:
1u3uA Crystal structure of human alcohol dehydrogenase beta-1-beta-1 isoform complexed with n-benzylformamide determined to 1.6 angstrom resolution (see paper)
30% identity, 97% coverage: 2:373/385 of query aligns to 10:364/374 of 1u3uA
- active site: C46 (= C38), R47 (≠ G39), T48 (≠ S40), H51 (= H43), H67 (= H59), E68 (= E60), C97 (= C89), C100 (= C92), C103 (= C95), C111 (= C103), D115 (≠ N107), C174 (≠ D169), T178 (= T173)
- binding n-benzylformamide: T48 (≠ S40), H67 (= H59), F93 (= F85), C174 (≠ D169), V294 (= V306)
- binding nicotinamide-adenine-dinucleotide: R47 (≠ G39), T48 (≠ S40), H51 (= H43), C174 (≠ D169), T178 (= T173), G199 (= G193), L200 (≠ S194), G201 (= G195), V203 (= V197), D223 (= D217), I224 (≠ P218), K228 (≠ R222), V268 (≠ A261), I269 (≠ V262), R271 (≠ F270), V292 (≠ M304), G293 (= G305), V294 (= V306), V318 (vs. gap)
- binding zinc ion: C46 (= C38), H67 (= H59), C97 (= C89), C100 (= C92), C103 (= C95), C111 (= C103), C174 (≠ D169)
Sites not aligning to the query:
1hdxB Three-dimensional structures of three human alcohol dehydrogenase variants: correlations with their functional differences (see paper)
30% identity, 97% coverage: 2:373/385 of query aligns to 10:364/374 of 1hdxB
- active site: C46 (= C38), R47 (≠ G39), T48 (≠ S40), H51 (= H43), H67 (= H59), E68 (= E60), C97 (= C89), C100 (= C92), C103 (= C95), C111 (= C103), D115 (≠ N107), C174 (≠ D169), T178 (= T173)
- binding cyclohexanol: L116 (≠ F108), V318 (vs. gap)
- binding nicotinamide-adenine-dinucleotide: C46 (= C38), R47 (≠ G39), H51 (= H43), T178 (= T173), L200 (≠ S194), G201 (= G195), G202 (≠ P196), V203 (= V197), D223 (= D217), I269 (≠ V262), R271 (≠ F270), V292 (≠ M304), G293 (= G305), V294 (= V306)
- binding zinc ion: C46 (= C38), H67 (= H59), C97 (= C89), C100 (= C92), C103 (= C95), C111 (= C103), C174 (≠ D169)
Sites not aligning to the query:
1dehA Crystallization of human beta1 alcohol dehydrogenase (15 mg/ml) in 50 mm sodium phosphate (ph 7.5), 2.0 mm NAD+ and 1 mm 4-iodopyrazole at 25 oc, 13% (w/v) peg 8000 (see paper)
30% identity, 97% coverage: 2:373/385 of query aligns to 10:364/374 of 1dehA
- active site: C46 (= C38), R47 (≠ G39), T48 (≠ S40), H51 (= H43), H67 (= H59), E68 (= E60), C97 (= C89), C100 (= C92), C103 (= C95), C111 (= C103), D115 (≠ N107), C174 (≠ D169), T178 (= T173)
- binding nicotinamide-adenine-dinucleotide: C46 (= C38), R47 (≠ G39), T48 (≠ S40), H51 (= H43), C174 (≠ D169), T178 (= T173), G201 (= G195), V203 (= V197), D223 (= D217), I224 (≠ P218), V268 (≠ A261), I269 (≠ V262), V292 (≠ M304), V294 (= V306)
- binding 4-iodopyrazole: T48 (≠ S40), H67 (= H59), F93 (= F85), L116 (≠ F108), C174 (≠ D169)
- binding zinc ion: C46 (= C38), H67 (= H59), C97 (= C89), C100 (= C92), C103 (= C95), C111 (= C103)
Sites not aligning to the query:
P80360 Alcohol dehydrogenase class-3; Alcohol dehydrogenase class-III; Glutathione-dependent formaldehyde dehydrogenase; FALDH; FDH; GSH-FDH; S-(hydroxymethyl)glutathione dehydrogenase; EC 1.1.1.1; EC 1.1.1.-; EC 1.1.1.284 from Myxine glutinosa (Atlantic hagfish) (see 2 papers)
29% identity, 96% coverage: 2:371/385 of query aligns to 11:364/376 of P80360
Sites not aligning to the query:
- 1 modified: N-acetylserine
P80338 Alcohol dehydrogenase 1; Alcohol dehydrogenase I; EC 1.1.1.1 from Struthio camelus (Common ostrich) (see 2 papers)
29% identity, 96% coverage: 2:371/385 of query aligns to 10:362/374 of P80338
Sites not aligning to the query:
- 1 modified: N-acetylserine
1u3wA Crystal structure of human alcohol dehydrogenase gamma-2-gamma-2 isoform complexed with n-1-methylheptylformamide determined to 1.45 angstrom resolution (see paper)
30% identity, 96% coverage: 2:371/385 of query aligns to 10:362/374 of 1u3wA
- active site: C46 (= C38), R47 (≠ G39), S48 (= S40), H51 (= H43), H67 (= H59), E68 (= E60), C97 (= C89), C100 (= C92), C103 (= C95), C111 (= C103), D115 (≠ N107), C174 (≠ D169), T178 (= T173)
- binding 1-methylheptylformamide: S48 (= S40), H67 (= H59), F93 (= F85), C174 (≠ D169)
- binding nicotinamide-adenine-dinucleotide: C46 (= C38), R47 (≠ G39), S48 (= S40), H51 (= H43), C174 (≠ D169), T178 (= T173), G199 (= G193), G201 (= G195), V203 (= V197), D223 (= D217), I224 (≠ P218), K228 (≠ R222), V268 (≠ A261), I269 (≠ V262), T274 (≠ K273), V292 (≠ M304), G293 (= G305), V294 (= V306), I318 (vs. gap)
- binding zinc ion: C46 (= C38), H67 (= H59), C97 (= C89), C100 (= C92), C103 (= C95), C111 (= C103), C174 (≠ D169)
Sites not aligning to the query:
Query Sequence
>CA265_RS12005 CA265_RS12005 glutathione-dependent formaldehyde dehydrogenase
MKAAVFHKPGDIRVDYVPDPKILDPRDVILKVTSTAICGSDLHILSGAVPQKDPLIMGHE
FMGIVEEVGASITNLKRGDRVVVPFPISCGKCFFCTHEASPACETSNFKNYGPNGDMMSQ
KGAALFGYTDLYGGYSGGQAQYVRVPYADISPRIVPEHLSDEQALFLTDIFPTGWSAIDW
AQLKGGEVVAIFGSGPVGLMAQKAAWINGASRVIAIDPLDYRLEKAKAVNNVDILNPHKV
DVVEAIREMTGGRGADLCVDAVGFEPERSFFDKVKATVHFEKGSIKVLEMCFEAVRRMGT
VSIMGVYGSPYDNFPLFRIFDKGITIKQGQAPVLNYIDKLIGLVNEGKVVLDDIITHTLP
LEDAAHGYKIFDNKEEDCVKVVLKP
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory