SitesBLAST
Comparing CA265_RS12250 FitnessBrowser__Pedo557:CA265_RS12250 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3ozmD Crystal structure of enolase superfamily member from bordetella bronchiseptica complexed with mg, m-xylarate and l-lyxarate
35% identity, 98% coverage: 1:381/388 of query aligns to 2:369/381 of 3ozmD
- active site: M20 (≠ K19), G53 (≠ A52), D56 (≠ G55), S143 (= S155), K170 (= K180), K172 (≠ R182), D200 (= D213), N202 (≠ H215), E226 (= E239), G252 (= G264), E253 (= E265), N254 (≠ S266), Q274 (= Q286), D276 (= D288), H303 (= H315), T304 (≠ C316), F305 (≠ W317), E328 (= E340), I331 (≠ L343), H333 (≠ G345)
- binding L-arabinaric acid: K172 (≠ R182), D200 (= D213), N202 (≠ H215), E253 (= E265), H303 (= H315), F305 (≠ W317), E328 (= E340)
- binding magnesium ion: D200 (= D213), E226 (= E239), E253 (= E265)
3ozmA Crystal structure of enolase superfamily member from bordetella bronchiseptica complexed with mg, m-xylarate and l-lyxarate
35% identity, 98% coverage: 1:381/388 of query aligns to 2:369/386 of 3ozmA
- active site: M20 (≠ K19), G53 (≠ A52), D56 (≠ G55), S143 (= S155), K170 (= K180), K172 (≠ R182), D200 (= D213), N202 (≠ H215), E226 (= E239), G252 (= G264), E253 (= E265), N254 (≠ S266), Q274 (= Q286), D276 (= D288), H303 (= H315), T304 (≠ C316), F305 (≠ W317), E328 (= E340), I331 (≠ L343), H333 (≠ G345)
- binding D-xylaric acid: S24 (= S23), K29 (≠ L28), Y146 (≠ W158), K170 (= K180), K172 (≠ R182), D200 (= D213), N202 (≠ H215), E253 (= E265), H303 (= H315), F305 (≠ W317), E328 (= E340)
- binding magnesium ion: D200 (= D213), E226 (= E239), E253 (= E265)
5olcC Crystal structure of the 3,6-anhydro-d-galactonate cycloisomerase from zobellia galactanivorans (see paper)
32% identity, 95% coverage: 15:384/388 of query aligns to 3:348/351 of 5olcC
- active site: K148 (= K180), K150 (≠ R182), D178 (= D213), N180 (≠ H215), E204 (= E239), G229 (= G264), E230 (= E265), D253 (= D288), H280 (= H315), E304 (= E340), E309 (≠ G345)
- binding magnesium ion: D178 (= D213), E204 (= E239), E230 (= E265)
3op2A Crystal structure of putative mandelate racemase from bordetella bronchiseptica rb50 complexed with 2-oxoglutarate/phosphate
34% identity, 98% coverage: 1:381/388 of query aligns to 2:364/375 of 3op2A
- active site: M20 (≠ K19), G53 (≠ A52), D56 (≠ G55), S138 (= S155), K165 (= K180), K167 (≠ R182), D195 (= D213), N197 (≠ H215), E221 (= E239), G247 (= G264), E248 (= E265), N249 (≠ S266), Q269 (= Q286), D271 (= D288), H298 (= H315), T299 (≠ C316), F300 (≠ W317), E323 (= E340), I326 (≠ L343), H328 (≠ G345)
- binding 2-oxoglutaric acid: K165 (= K180), K167 (≠ R182), D195 (= D213), E248 (= E265), H298 (= H315), E323 (= E340)
- binding magnesium ion: D195 (= D213), E221 (= E239), E248 (= E265)
4hpnA Crystal structure of a proposed galactarolactone cycloisomerase from agrobacterium tumefaciens, target efi-500704, with bound ca, ordered loops (see paper)
31% identity, 96% coverage: 15:385/388 of query aligns to 3:374/378 of 4hpnA
- active site: F19 (= F31), G50 (= G55), R53 (≠ G58), T134 (≠ S155), K164 (= K180), K166 (≠ R182), D194 (= D213), N196 (≠ H215), E220 (= E239), G245 (= G264), E246 (= E265), T247 (≠ S266), Q267 (= Q286), D269 (= D288), H296 (= H315), V297 (≠ C316), W298 (= W317), R320 (≠ S333), E329 (= E340), F330 (= F341), H334 (≠ G345)
- binding calcium ion: D194 (= D213), D209 (≠ R228), E220 (= E239), G237 (≠ A256), E246 (= E265)
3sjnA Crystal structure of enolase spea_3858 (target efi-500646) from shewanella pealeana with magnesium bound
31% identity, 99% coverage: 1:385/388 of query aligns to 2:371/373 of 3sjnA
- active site: S46 (≠ A52), L49 (vs. gap), T139 (≠ S155), K165 (= K180), G167 (≠ R182), M171 (= M186), D198 (= D213), A200 (= A214), E225 (= E239), I247 (= I261), G250 (= G264), E251 (= E265), S252 (= S266), Q272 (= Q286), D274 (= D288), H301 (= H315), G302 (≠ C316), F303 (≠ W317), M325 (≠ I339), E326 (= E340), Q329 (≠ L343), S331 (≠ G345)
- binding magnesium ion: D198 (= D213), E225 (= E239), E251 (= E265)
3bjsB Crystal structure of a member of enolase superfamily from polaromonas sp. Js666
28% identity, 99% coverage: 1:384/388 of query aligns to 1:366/376 of 3bjsB
- active site: V18 (≠ A18), P49 (≠ A52), S52 (≠ G55), L93 (= L100), G136 (≠ S155), K164 (= K180), R166 (= R182), D194 (= D213), N196 (≠ H215), E220 (= E239), G246 (= G264), E247 (= E265), N248 (≠ S266), Q268 (= Q286), D270 (= D288), H297 (= H315), S298 (≠ C316), S299 (≠ W317), E322 (= E340), C324 (≠ S342), K327 (≠ G345)
- binding magnesium ion: D194 (= D213), E220 (= E239), E247 (= E265)
2qq6B Crystal structure of mandelate racemase/muconate lactonizing enzyme- like protein from rubrobacter xylanophilus dsm 9941
33% identity, 85% coverage: 45:374/388 of query aligns to 30:376/396 of 2qq6B
- active site: P37 (≠ A52), G79 (= G110), D124 (vs. gap), K166 (= K180), D168 (≠ R182), D213 (= D213), H215 (= H215), E239 (= E239), G264 (= G264), E265 (= E265), M286 (≠ Q286), D288 (= D288), H315 (= H315), N316 (≠ C316), E340 (= E340), D345 (≠ G345)
- binding magnesium ion: D213 (= D213), E239 (= E239), E265 (= E265), H315 (= H315)
4e6mA Crystal structure of putative dehydratase protein from salmonella enterica subsp. Enterica serovar typhimurium (salmonella typhimurium)
31% identity, 99% coverage: 1:384/388 of query aligns to 2:395/401 of 4e6mA
- active site: L45 (≠ A52), G48 (= G55), K169 (= K180), D171 (vs. gap), I175 (vs. gap), E223 (≠ D213), H225 (= H215), E249 (= E239), G274 (= G264), E275 (= E265), R276 (≠ S266), Q296 (= Q286), D298 (= D288), H325 (= H315), C327 (≠ W317), E350 (= E340), A355 (≠ G345)
- binding magnesium ion: E223 (≠ D213), E249 (= E239), E275 (= E265)
4h19A Crystal structure of an enolase (mandelate racemase subgroup, target efi-502087) from agrobacterium tumefaciens, with bound mg and d- ribonohydroxamate, ordered loop
30% identity, 100% coverage: 1:388/388 of query aligns to 1:371/372 of 4h19A
- active site: I20 (≠ V22), T51 (≠ S56), T143 (≠ S155), K172 (= K180), K174 (≠ R182), D203 (= D213), N205 (≠ H215), E229 (= E239), G254 (= G264), E255 (= E265), Q276 (= Q286), D278 (= D288), H305 (= H315), A306 (≠ C316), G307 (= G318), E327 (= E340)
- binding (2R,3R,4R)-N,2,3,4,5-pentakis(oxidanyl)pentanamide: D22 (= D24), H25 (≠ L27), H52 (≠ C57), K172 (= K180), K174 (≠ R182), D203 (= D213), N205 (≠ H215), E229 (= E239), E255 (= E265), H305 (= H315), E327 (= E340)
- binding calcium ion: D268 (≠ Q278), H298 (= H308)
- binding magnesium ion: D203 (= D213), E229 (= E239), E255 (= E265)
2ox4C Crystal structure of putative dehydratase from zymomonas mobilis zm4
29% identity, 96% coverage: 1:373/388 of query aligns to 2:375/397 of 2ox4C
- active site: K165 (= K180), D167 (≠ R182), E214 (≠ D213), H216 (= H215), E240 (= E239), G265 (= G264), E266 (= E265), Q287 (= Q286), D289 (= D288), H316 (= H315), E341 (= E340)
- binding magnesium ion: E214 (≠ D213), E240 (= E239), E266 (= E265)
3rraB Crystal structure of enolase prk14017 (target efi-500653) from ralstonia pickettii 12j with magnesium bound
33% identity, 87% coverage: 38:374/388 of query aligns to 21:345/379 of 3rraB
- active site: I35 (≠ A52), R38 (≠ G55), Y118 (= Y153), K145 (= K180), N147 (vs. gap), E151 (≠ R182), D184 (= D213), H186 (= H215), E210 (= E239), G235 (= G264), E236 (= E265), R237 (≠ S266), Q257 (= Q286), D259 (= D288), H286 (= H315), P288 (≠ W317), E311 (= E340)
- binding magnesium ion: D184 (= D213), E210 (= E239), E236 (= E265)
Q6BF17 D-galactonate dehydratase; GalD; EC 4.2.1.6 from Escherichia coli (strain K12)
32% identity, 90% coverage: 38:387/388 of query aligns to 20:363/382 of Q6BF17
- H185 (= H215) mutation H->N,Q: Loss of activity.
- H285 (= H315) mutation to N: Loss of activity.
- E310 (= E340) mutation to Q: Loss of activity.
4h83F Crystal structure of mandelate racemase/muconate lactonizing enzyme (efi target:502127)
28% identity, 100% coverage: 1:387/388 of query aligns to 2:368/368 of 4h83F
- active site: F20 (≠ H21), D51 (≠ G55), I139 (≠ S155), K166 (= K180), K168 (≠ R182), I196 (≠ V212), D197 (= D213), A198 (= A214), N199 (≠ H215), E223 (= E239), G249 (= G264), Q250 (≠ E265), N271 (≠ Q286), D273 (= D288), H300 (= H315), E301 (≠ C316), E302 (≠ W317), E320 (= E340), D325 (≠ G344)
- binding bicarbonate ion: R220 (≠ Y236), I318 (= I338)
5xd8B Crystal structure analysis of 3,6-anhydro-l-galactonate cycloisomerase (see paper)
29% identity, 99% coverage: 3:385/388 of query aligns to 5:361/367 of 5xd8B
- active site: S22 (= S23), T53 (≠ G55), G140 (≠ S155), K167 (= K180), K169 (≠ R182), D198 (= D213), N200 (≠ H215), E224 (= E239), G249 (= G264), E250 (= E265), Q271 (= Q286), D273 (= D288), H300 (≠ G318), G301 (≠ S319), M302 (≠ A320), W317 (≠ S335), E319 (≠ T337), P324 (≠ S342)
- binding magnesium ion: D198 (= D213), E224 (= E239), E250 (= E265)
3no1A Crystal structure of mandelate racemase/muconate lactonizing enzyme from a marine actinobacterium in complex with magnesium
30% identity, 83% coverage: 63:385/388 of query aligns to 47:354/355 of 3no1A
- active site: I127 (≠ S155), K154 (= K180), K156 (≠ R182), I184 (≠ V212), D185 (= D213), A186 (= A214), N187 (≠ H215), E211 (= E239), G237 (= G264), Q238 (≠ E265), N259 (≠ Q286), D261 (= D288), H288 (= H315), E289 (≠ C316), E290 (≠ W317), E308 (= E340), D313 (≠ G344)
- binding magnesium ion: D185 (= D213), E211 (= E239), Q238 (≠ E265)
Sites not aligning to the query:
3cb3A Crystal structure of l-talarate dehydratase from polaromonas sp. Js666 complexed with mg and l-glucarate
32% identity, 94% coverage: 11:375/388 of query aligns to 16:355/373 of 3cb3A
- active site: K24 (= K19), S57 (≠ A52), T143 (≠ S155), K171 (= K180), K173 (≠ R182), D202 (= D213), N204 (≠ H215), E228 (= E239), G253 (= G264), E254 (= E265), M275 (≠ Q286), D277 (= D288), H304 (= H315), F305 (= F321), A306 (≠ S322), E324 (= E340)
- binding l-glucaric acid: K171 (= K180), K173 (≠ R182), D202 (= D213), E254 (= E265), H304 (= H315)
- binding magnesium ion: D202 (= D213), E228 (= E239), A243 (≠ R254), F246 (≠ T257), E254 (= E265)
2og9A Crystal structure of mandelate racemase/muconate lactonizing enzyme from polaromonas sp. Js666
31% identity, 94% coverage: 10:375/388 of query aligns to 7:344/363 of 2og9A
- active site: S46 (≠ A52), T132 (≠ S155), K160 (= K180), K162 (≠ R182), D191 (= D213), N193 (≠ H215), E217 (= E239), G242 (= G264), E243 (= E265), M264 (≠ Q286), D266 (= D288), H293 (= H315), F294 (= F321), A295 (≠ S322), E313 (= E340)
- binding calcium ion: A232 (≠ R254), F235 (≠ T257)
3ekgA Crystal structure of l-rhamnonate dehydratase from azotobacter vinelandii complexed with mg and l-tartrate
32% identity, 79% coverage: 16:323/388 of query aligns to 43:326/395 of 3ekgA
- active site: K178 (≠ F176), P180 (≠ G178), G184 (≠ R182), S186 (≠ G184), E190 (≠ D188), D215 (= D213), W217 (≠ H215), E241 (= E239), T266 (≠ A262), G268 (= G264), E269 (= E265), Q290 (= Q286), D292 (= D288), H319 (= H315)
- binding magnesium ion: D215 (= D213), E241 (= E239), E269 (= E265)
Sites not aligning to the query:
3sqsA Crystal structure of a putative mandelate racemase/muconate lactonizing protein from dinoroseobacter shibae dfl 12
28% identity, 86% coverage: 54:385/388 of query aligns to 57:383/386 of 3sqsA
- active site: L62 (≠ I59), N65 (≠ S62), S147 (= S155), K173 (= K180), R175 (= R182), G177 (= G184), G179 (≠ M186), K181 (≠ D188), A185 (vs. gap), E210 (≠ D213), Y212 (≠ H215), E236 (= E239), G261 (= G264), E262 (= E265), H263 (≠ S266), Q283 (= Q286), D285 (= D288), I307 (≠ V310), H312 (= H315), G314 (= G318), E332 (≠ A336), F337 (= F341)
- binding magnesium ion: E210 (≠ D213), E236 (= E239), E262 (= E265), Y347 (= Y350), F350 (≠ V353), D351 (≠ N354)
Query Sequence
>CA265_RS12250 FitnessBrowser__Pedo557:CA265_RS12250
MKITNVEAFWLRCPIPEAKQHVSDYGLLTSFDMTLVVITTDSGLQGFGEAKAAVGSCGIC
ASIVNCIENELKPMLLGKSVKNITRLWEEMYNGTRDHYALSRGRKFPILGRRGLTISAMS
GIDTALWDLKGKMLNVPVADLLGGACRTKMPAYASGGWADEQNIGEQLMGYVNKGFKGVK
MRVGVMDDTVQKSINRVKAARAALGPDIKLMVDAHGTFSVPEAKQFCRGVEDCNVYWFEE
PISPDNRKGTAEVRAATDIPIAAGESEFTSFDIHDLLQIRAIDVVQPDAAIIGGISEAMR
VSHLASVHQVELAPHCWGSAFSFMAGLTVAFASASATIIEFSLGGNPMMYDLVNEQIAVV
NGEISAPTAPGLGLTPNWDFVKQFKQSV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory