Comparing CA265_RS12255 FitnessBrowser__Pedo557:CA265_RS12255 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7x7wA The x-ray crystallographic structure of d-psicose 3-epimerase from clostridia bacterium
31% identity, 74% coverage: 18:234/294 of query aligns to 22:244/288 of 7x7wA
4ytuA Crystal structure of d-tagatose 3-epimerase c66s from pseudomonas cichorii in complex with l-erythrulose (see paper)
30% identity, 74% coverage: 16:234/294 of query aligns to 21:246/294 of 4ytuA
Sites not aligning to the query:
4yttA Crystal structure of d-tagatose 3-epimerase c66s from pseudomonas cichorii in complex with 6-deoxy l-psicose (see paper)
30% identity, 74% coverage: 16:234/294 of query aligns to 21:246/294 of 4yttA
Sites not aligning to the query:
4ytsA Crystal structure of d-tagatose 3-epimerase c66s from pseudomonas cichorii in complex with 1-deoxy 3-keto d-galactitol (see paper)
30% identity, 74% coverage: 16:234/294 of query aligns to 21:246/294 of 4ytsA
Sites not aligning to the query:
4ytrA Crystal structure of d-tagatose 3-epimerase c66s from pseudomonas cichorii in complex with 1-deoxy l-tagatose (see paper)
30% identity, 74% coverage: 16:234/294 of query aligns to 21:246/294 of 4ytrA
Sites not aligning to the query:
4ytqA Crystal structure of d-tagatose 3-epimerase c66s from pseudomonas cichorii in complex with 1-deoxy d-tagatose (see paper)
30% identity, 74% coverage: 16:234/294 of query aligns to 21:246/294 of 4ytqA
Sites not aligning to the query:
4xsmA Crystal structure of d-tagatose 3-epimerase c66s from pseudomonas cichorii in complex with d-talitol (see paper)
30% identity, 74% coverage: 16:234/294 of query aligns to 21:246/294 of 4xsmA
Q9WYP7 5-keto-L-gluconate epimerase; Bifunctional nonphosphorylated sugar isomerase; D-erythrose/D-threose isomerase; L-ribulose 3-epimerase; R3E; Nonphosphorylated sugar 3-epimerase; Nonphosphorylated sugar aldose-ketose isomerase; EC 5.1.3.-; EC 5.1.3.-; EC 5.3.1.- from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
42% identity, 50% coverage: 110:256/294 of query aligns to 119:256/270 of Q9WYP7
4ytrC Crystal structure of d-tagatose 3-epimerase c66s from pseudomonas cichorii in complex with 1-deoxy l-tagatose (see paper)
30% identity, 74% coverage: 16:234/294 of query aligns to 21:246/297 of 4ytrC
Sites not aligning to the query:
4ytqC Crystal structure of d-tagatose 3-epimerase c66s from pseudomonas cichorii in complex with 1-deoxy d-tagatose (see paper)
30% identity, 74% coverage: 16:234/294 of query aligns to 21:246/297 of 4ytqC
Sites not aligning to the query:
5h1wA Crystal structure of hyperthermophilic thermotoga maritima l-ketose-3- epimerase with mn2+ and l(+)-erythrulose (see paper)
42% identity, 50% coverage: 110:256/294 of query aligns to 120:257/270 of 5h1wA
5b80A Crystal structure of hyperthermophilic thermotoga maritima l-ketose-3- epimerase with cu2+ (see paper)
42% identity, 50% coverage: 110:256/294 of query aligns to 119:256/269 of 5b80A
5b7yA Crystal structure of hyperthermophilic thermotoga maritima l-ketose-3- epimerase with co2+ (see paper)
42% identity, 50% coverage: 110:256/294 of query aligns to 119:256/269 of 5b7yA
2qumA Crystal structure of d-tagatose 3-epimerase from pseudomonas cichorii with d-tagatose (see paper)
30% identity, 74% coverage: 16:234/294 of query aligns to 21:246/290 of 2qumA
Sites not aligning to the query:
O50580 D-tagatose 3-epimerase; DTE; D-ribulose 3-epimerase; Ketose 3-epimerase; EC 5.1.3.31 from Pseudomonas cichorii (see 2 papers)
30% identity, 74% coverage: 16:234/294 of query aligns to 21:246/290 of O50580
4pglA Crystal structure of engineered d-tagatose 3-epimerase pcdte-ils6 (see paper)
30% identity, 77% coverage: 16:242/294 of query aligns to 21:251/298 of 4pglA
Sites not aligning to the query:
4pfhA Crystal structure of engineered d-tagatose 3-epimerase pcdte-idf8 (see paper)
30% identity, 77% coverage: 16:242/294 of query aligns to 21:251/298 of 4pfhA
Sites not aligning to the query:
2hk1A Crystal structure of d-psicose 3-epimerase (dpease) in the presence of d-fructose (see paper)
30% identity, 74% coverage: 18:234/294 of query aligns to 22:244/289 of 2hk1A
A9CH28 D-psicose 3-epimerase; DPEase; EC 5.1.3.30 from Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58)) (see paper)
30% identity, 74% coverage: 18:234/294 of query aligns to 22:244/289 of A9CH28
B8I944 D-psicose 3-epimerase; DPEase; EC 5.1.3.30 from Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) (Clostridium cellulolyticum) (see paper)
29% identity, 74% coverage: 18:234/294 of query aligns to 22:244/293 of B8I944
Sites not aligning to the query:
>CA265_RS12255 FitnessBrowser__Pedo557:CA265_RS12255
MELAIHNWMRAETIETTVRRVSAIGYTRLEIAGTPDQYNTKDLQKLMKEHGLSCWGSVTL
MLGERNLLARNEAQRAASVQYVKDVVNMVKELDGYMVSVVPGTVGKIVPDGRPEEEWAWA
VNSMKEIYEYSESAGISLGIEPINRFETYFINRAEQALALAAEVGPNCGVCLDTFHMNIE
ERDMFEAIKMAKDRLVGFHVADNNRMAPGMGNLDWQKIVDTLHEVNYKGALSVEFCSPLD
RTPANPYPGSIDEKPENLSPEQEKFLIDHGSSSVTDAFYTMLTKASYHTLSKLI
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory