SitesBLAST
Comparing CA265_RS12480 FitnessBrowser__Pedo557:CA265_RS12480 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q7JK39 Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase; D-xylose 1-dehydrogenase; D-xylose-NADP dehydrogenase; Dimeric dihydrodiol dehydrogenase; Jmo2DD; EC 1.3.1.20; EC 1.1.1.179 from Macaca fuscata fuscata (Japanese macaque) (see paper)
29% identity, 86% coverage: 4:282/323 of query aligns to 3:273/334 of Q7JK39
- H79 (= H79) mutation to E: Decrease in K(d) and K(m) value for NADPH. Elimination of the fluorescence-energy transfer and enhancement of NADPH fluorescence by the binary complex formation. Potent inhibition of the dehydrogenase activity by high ionic strength.
- Y180 (≠ H188) mutation to F: Significant loss of activity. No effect on the high affinity for NADPH, fluorescence-energy transfer and enhancement of NADPH fluorescence by the binary complex formation.
Q9TQS6 Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase; Cmo2DD; D-xylose 1-dehydrogenase; D-xylose-NADP dehydrogenase; Dimeric dihydrodiol dehydrogenase; EC 1.3.1.20; EC 1.1.1.179 from Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey) (see paper)
29% identity, 86% coverage: 4:282/323 of query aligns to 3:273/334 of Q9TQS6
- R148 (= R148) mutation to A: No effect on activity. Reduced activity and exhibits significant temperature sensitivity; when associated with A-202.
- R202 (= R209) mutation to A: No effect on activity. Reduced activity and exhibits significant temperature sensitivity; when associated with A-148.
2poqX Dimeric dihydrodiol dehydrogenase complexed with inhibitor, isoascorbic acid (see paper)
29% identity, 86% coverage: 4:282/323 of query aligns to 2:272/331 of 2poqX
Sites not aligning to the query:
2o4uX Crystal structure of mammalian dimeric dihydrodiol dehydrogenase (see paper)
29% identity, 86% coverage: 4:282/323 of query aligns to 2:272/331 of 2o4uX
- binding phosphate ion: L2 (≠ I4), S8 (≠ G10), V9 (≠ C11), A35 (≠ R36), R36 (= R37), R40 (≠ K41), Y57 (≠ A58), N101 (≠ D102), A103 (≠ D104), D145 (= D146), R147 (= R148), K155 (≠ P158), Q232 (= Q243), S234 (≠ A246), T236 (≠ I248), Q247 (≠ S259), N250 (vs. gap), W253 (≠ F263)
Sites not aligning to the query:
Q2I8V6 1,5-anhydro-D-fructose reductase; Anhydrofructose reductase; 1,5-anhydro-D-fructose reductase (1,5-anhydro-D-mannitol-forming); EC 1.1.1.292 from Ensifer adhaerens (Sinorhizobium morelense) (see paper)
26% identity, 70% coverage: 5:231/323 of query aligns to 3:225/333 of Q2I8V6
- ASTI 9:12 (≠ CGDV 11:14) binding
- S10 (≠ G12) mutation to G: Almost no effect.
- A13 (≠ T15) mutation to G: Can use NAD as cosubstrate as well as NADP.
- S33 (≠ R36) mutation to D: No activity.
- ST 33:34 (≠ RR 36:37) binding
- R38 (≠ K41) binding
- TTNELH 71:76 (≠ TPPLQH 74:79) binding
- EK 93:94 (= EK 96:97) binding
- K94 (= K97) mutation to G: Less than 1% remaining activity.
- N120 (≠ A123) binding
- WR 162:163 (= WR 170:171) binding
- D176 (= D184) mutation to A: Less than 1% remaining activity.
- H180 (= H188) mutation to A: Less than 2% remaining activity.
- G206 (≠ A207) mutation to I: No effect.
Sites not aligning to the query:
1rydA Crystal structure of glucose-fructose oxidoreductase from zymomonas mobilis
28% identity, 72% coverage: 2:235/323 of query aligns to 28:268/381 of 1rydA
- active site: K129 (= K97), Y217 (≠ H188)
- binding alpha-D-glucopyranose: Y236 (≠ A207), I254 (≠ A221), Q256 (≠ N223)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: L39 (≠ C11), G40 (= G12), K41 (≠ D13), Y42 (≠ V14), S64 (≠ R36), G65 (≠ R37), K69 (= K41), Y87 (= Y55), L106 (≠ T74), P107 (= P75), N108 (≠ P76), L110 (≠ Q78), H111 (= H79), E128 (= E96), K129 (= K97), R157 (≠ Y125), A196 (= A167), W199 (= W170), R200 (= R171), Y217 (≠ H188)
Sites not aligning to the query:
1h6dA Oxidized precursor form of glucose-fructose oxidoreductase from zymomonas mobilis complexed with glycerol (see paper)
28% identity, 72% coverage: 2:235/323 of query aligns to 30:270/383 of 1h6dA
- active site: K131 (= K97), Y219 (≠ H188)
- binding glycerol: K131 (= K97), R202 (= R171), D215 (= D184), Y219 (≠ H188)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G40 (= G10), L41 (≠ C11), G42 (= G12), K43 (≠ D13), Y44 (≠ V14), S66 (≠ R36), G67 (≠ R37), K71 (= K41), Y89 (= Y55), I107 (≠ A73), L108 (≠ T74), P109 (= P75), N110 (≠ P76), H113 (= H79), E130 (= E96), K131 (= K97), R159 (≠ Y125), A198 (= A167), W201 (= W170), R202 (= R171), Y219 (≠ H188)
Sites not aligning to the query:
1evjA Crystal structure of glucose-fructose oxidoreductase (gfor) delta1-22 s64d (see paper)
27% identity, 71% coverage: 6:235/323 of query aligns to 5:239/340 of 1evjA
- active site: K100 (= K97), Y188 (≠ H188)
- binding nicotinamide-adenine-dinucleotide: G9 (= G10), L10 (≠ C11), G11 (= G12), K12 (≠ D13), Y13 (≠ V14), D35 (≠ R36), L77 (≠ T74), P78 (= P75), N79 (≠ P76), H82 (= H79), E99 (= E96), K100 (= K97), R128 (≠ Y125), W170 (= W170), R171 (= R171), Y188 (≠ H188)
Sites not aligning to the query:
5a05A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with maltotriose (see paper)
25% identity, 74% coverage: 2:240/323 of query aligns to 1:241/335 of 5a05A
- active site: K100 (= K97), Y185 (≠ H188)
- binding beta-D-glucopyranose: K100 (= K97), F159 (≠ L162), D181 (= D184), Y185 (≠ H188)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G9 (= G10), L10 (≠ C11), G11 (= G12), Y12 (≠ D13), Y13 (≠ V14), S35 (≠ R36), G36 (≠ R37), T37 (≠ D38), K40 (= K41), Y58 (= Y55), I76 (≠ A73), T77 (= T74), P78 (= P75), N79 (≠ P76), L81 (≠ Q78), H82 (= H79), E99 (= E96), K100 (= K97), R128 (≠ Y125), W167 (= W170), R168 (= R171), Y185 (≠ H188)
Sites not aligning to the query:
5a04A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with glucose (see paper)
25% identity, 74% coverage: 2:240/323 of query aligns to 1:241/335 of 5a04A
- active site: K100 (= K97), Y185 (≠ H188)
- binding beta-D-glucopyranose: K100 (= K97), F159 (≠ L162), R168 (= R171), D181 (= D184), Y185 (≠ H188)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: L10 (≠ C11), G11 (= G12), Y12 (≠ D13), Y13 (≠ V14), S35 (≠ R36), G36 (≠ R37), T37 (≠ D38), K40 (= K41), Y58 (= Y55), I76 (≠ A73), T77 (= T74), P78 (= P75), N79 (≠ P76), L81 (≠ Q78), H82 (= H79), E99 (= E96), K100 (= K97), R128 (≠ Y125), W167 (= W170), R168 (= R171), Y185 (≠ H188)
Sites not aligning to the query:
5a03E Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with xylose (see paper)
25% identity, 74% coverage: 2:240/323 of query aligns to 1:241/335 of 5a03E
- active site: K100 (= K97), Y185 (≠ H188)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G9 (= G10), L10 (≠ C11), G11 (= G12), Y12 (≠ D13), Y13 (≠ V14), S35 (≠ R36), G36 (≠ R37), T37 (≠ D38), K40 (= K41), Y58 (= Y55), I76 (≠ A73), T77 (= T74), P78 (= P75), N79 (≠ P76), H82 (= H79), E99 (= E96), K100 (= K97), R128 (≠ Y125), W167 (= W170), R168 (= R171), Y185 (≠ H188)
- binding beta-D-xylopyranose: K100 (= K97), F159 (≠ L162), R168 (= R171), D181 (= D184), Y185 (≠ H188), E205 (≠ G205), T207 (≠ A207), R209 (= R209)
- binding alpha-D-xylopyranose: H134 (≠ M131)
Sites not aligning to the query:
5a02A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with glycerol (see paper)
25% identity, 74% coverage: 2:240/323 of query aligns to 1:241/335 of 5a02A
- active site: K100 (= K97), Y185 (≠ H188)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: L10 (≠ C11), G11 (= G12), Y12 (≠ D13), Y13 (≠ V14), S35 (≠ R36), G36 (≠ R37), T37 (≠ D38), K40 (= K41), Y58 (= Y55), I76 (≠ A73), T77 (= T74), P78 (= P75), L81 (≠ Q78), H82 (= H79), E99 (= E96), K100 (= K97), R128 (≠ Y125), W167 (= W170), R168 (= R171), Y185 (≠ H188)
Sites not aligning to the query:
5a06A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with sorbitol (see paper)
25% identity, 74% coverage: 2:240/323 of query aligns to 2:242/336 of 5a06A
- active site: K101 (= K97), Y186 (≠ H188)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: L11 (≠ C11), G12 (= G12), Y13 (≠ D13), Y14 (≠ V14), S36 (≠ R36), G37 (≠ R37), T38 (≠ D38), K41 (= K41), Y59 (= Y55), I77 (≠ A73), T78 (= T74), P79 (= P75), N80 (≠ P76), L82 (≠ Q78), H83 (= H79), E100 (= E96), K101 (= K97), R129 (≠ Y125), W168 (= W170), R169 (= R171), Y186 (≠ H188)
- binding sorbitol: R2 (≠ E2), D72 (≠ N68), H96 (≠ P92), K101 (= K97), R122 (≠ V118), R122 (≠ V118), L124 (= L120), F160 (≠ L162), R169 (= R171), D182 (= D184), Y186 (≠ H188)
Sites not aligning to the query:
5a03C Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with xylose (see paper)
25% identity, 74% coverage: 2:240/323 of query aligns to 2:242/336 of 5a03C
- active site: K101 (= K97), Y186 (≠ H188)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G10 (= G10), L11 (≠ C11), G12 (= G12), Y13 (≠ D13), Y14 (≠ V14), S36 (≠ R36), G37 (≠ R37), T38 (≠ D38), K41 (= K41), Y59 (= Y55), I77 (≠ A73), T78 (= T74), P79 (= P75), N80 (≠ P76), L82 (≠ Q78), H83 (= H79), E100 (= E96), K101 (= K97), R129 (≠ Y125), W168 (= W170), R169 (= R171), Y186 (≠ H188)
- binding beta-D-xylopyranose: K101 (= K97), F160 (≠ L162), R169 (= R171), D182 (= D184), Y186 (≠ H188)
Sites not aligning to the query:
2glxA Crystal structure analysis of bacterial 1,5-af reductase (see paper)
26% identity, 70% coverage: 5:231/323 of query aligns to 2:224/332 of 2glxA
- active site: K93 (= K97), H179 (= H188)
- binding acetate ion: K93 (= K97), H179 (= H188)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G7 (= G10), A8 (≠ C11), S9 (≠ G12), T10 (≠ D13), I11 (≠ V14), S32 (≠ R36), T33 (≠ R37), R37 (≠ K41), S69 (≠ A73), T70 (= T74), N72 (≠ P76), H75 (= H79), E92 (= E96), K93 (= K97), H121 (≠ Y125), W161 (= W170), R162 (= R171)
Sites not aligning to the query:
4koaA Crystal structure analysis of 1,5-anhydro-d-fructose reductase from sinorhizobium meliloti (see paper)
26% identity, 71% coverage: 4:231/323 of query aligns to 2:225/333 of 4koaA
- active site: K94 (= K97), H180 (= H188)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G10), A9 (≠ C11), S10 (≠ G12), T11 (≠ D13), I12 (≠ V14), S33 (≠ R36), S34 (≠ R37), R38 (≠ K41), T71 (= T74), N73 (≠ P76), H76 (= H79), K94 (= K97), Q160 (≠ D168)
1zh8A Crystal structure of oxidoreductase (tm0312) from thermotoga maritima at 2.50 a resolution
25% identity, 80% coverage: 1:259/323 of query aligns to 1:255/325 of 1zh8A
- active site: K98 (= K97), H187 (= H188)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G10 (= G10), C11 (= C11), G12 (= G12), I13 (≠ D13), A14 (≠ V14), S37 (≠ R36), R38 (= R37), T39 (≠ D38), H42 (≠ K41), T74 (≠ A73), L75 (≠ T74), P76 (= P75), L79 (≠ Q78), E97 (= E96), K98 (= K97), N126 (≠ Y125), Y165 (≠ A164), W170 (= W170), R171 (= R171), H187 (= H188)
Sites not aligning to the query:
4n54A Crystal structure of scyllo-inositol dehydrogenase from lactobacillus casei with bound cofactor NAD(h) and scyllo-inositol
28% identity, 60% coverage: 4:198/323 of query aligns to 3:193/340 of 4n54A
- active site: K96 (= K97), H183 (= H188)
- binding (1r,2r,3r,4r,5r,6r)-cyclohexane-1,2,3,4,5,6-hexol: R12 (≠ D13), K96 (= K97), D156 (≠ N159), D179 (= D184), M180 (≠ L185), H183 (= H188)
- binding 1,4-dihydronicotinamide adenine dinucleotide: V8 (≠ I9), G9 (= G10), L10 (≠ C11), G11 (= G12), R12 (≠ D13), L13 (≠ V14), S35 (≠ R36), V36 (≠ R37), E40 (≠ K41), S73 (≠ T74), P74 (= P75), F77 (≠ Q78), H78 (= H79), E95 (= E96), K96 (= K97), M125 (≠ Y125), F167 (≠ I172)
Sites not aligning to the query:
- binding (1r,2r,3r,4r,5r,6r)-cyclohexane-1,2,3,4,5,6-hexol: 238, 244
- binding 1,4-dihydronicotinamide adenine dinucleotide: 284
6a3iA Levoglucosan dehydrogenase, complex with nadh and levoglucosan (see paper)
30% identity, 68% coverage: 40:260/323 of query aligns to 46:272/372 of 6a3iA
- binding Levoglucosan: K103 (= K97), Y132 (≠ R126), Y160 (≠ M154), Q162 (= Q156), R175 (= R171), D188 (= D184), H192 (= H188)
- binding 1,4-dihydronicotinamide adenine dinucleotide: P81 (= P75), N82 (≠ P76), L84 (≠ Q78), H85 (= H79), E102 (= E96), K103 (= K97), W174 (= W170), R175 (= R171)
Sites not aligning to the query:
3q2kK Crystal structure of the wlba dehydrogenase from bordetella pertussis in complex with nadh and udp-glcnaca (see paper)
22% identity, 100% coverage: 2:323/323 of query aligns to 1:310/322 of 3q2kK
- active site: K95 (= K97), H183 (= H188)
- binding (2S,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4-dihydroxy-oxane-2-carboxylic acid: R12 (≠ D13), K95 (= K97), T155 (≠ S157), R156 (≠ P158), Y160 (≠ L162), N179 (≠ D184), Q180 (≠ L185), H183 (= H188), N239 (≠ D244)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G9 (= G10), G11 (= G12), R12 (≠ D13), I13 (≠ V14), D35 (≠ R36), T36 (≠ R37), T72 (= T74), P73 (= P75), S74 (≠ P76), L76 (≠ Q78), H77 (= H79), E94 (= E96), K95 (= K97), Q123 (≠ Y125), W166 (= W170), R167 (= R171), H183 (= H188)
Query Sequence
>CA265_RS12480 FitnessBrowser__Pedo557:CA265_RS12480
MEEIRWGIIGCGDVTEVKSGPAFNKVNHAKLVAVMRRDGEKAADYARRHQVPKWYDDATQ
LINDPEVNAIYIATPPLQHEAYTIEALKAGKPVYVEKPMTLDADAAQRMTDAANQLKVKL
SVAHYRRAQPMFLKVKELLAAHSIGDIRLVRLKMLQSPNPALIAKTADNWRINPAISGGG
LFHDLAPHQLDLMTYYFGAVKNAIGIATRQQENTEVDDLVAGNILFENGIVFSGTWCFSV
APQDQADICVIYGSKGHISFPMFGNKITVTTDQTAEFVFEPLQHVQQPMIEKVVDYFLGK
GQNPCSGEDALITMKLMDDFTRK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory