Comparing CA265_RS12640 FitnessBrowser__Pedo557:CA265_RS12640 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q72J02 Sulfur carrier protein adenylyltransferase; E1-like protein TtuC; Sulfur carrier protein MoaD adenylyltransferase; Sulfur carrier protein ThiS adenylyltransferase; Sulfur carrier protein TtuB adenylyltransferase; tRNA two-thiouridine-synthesizing protein C; EC 2.7.7.80; EC 2.7.7.73; EC 2.7.7.- from Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) (see paper)
49% identity, 61% coverage: 4:228/368 of query aligns to 9:234/271 of Q72J02
Sites not aligning to the query:
O59954 Adenylyltransferase and sulfurtransferase uba4; Common component for nitrate reductase and xanthine dehydrogenase protein F; Ubiquitin-like protein activator 4; EC 2.7.7.80; EC 2.8.1.11 from Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans) (see paper)
32% identity, 98% coverage: 5:364/368 of query aligns to 68:474/482 of O59954
Q9VLJ8 Adenylyltransferase and sulfurtransferase MOCS3; Molybdenum cofactor synthesis protein 3; Ubiquitin activating enzyme 4; EC 2.7.7.80; EC 2.8.1.11 from Drosophila melanogaster (Fruit fly) (see paper)
34% identity, 93% coverage: 5:345/368 of query aligns to 71:427/453 of Q9VLJ8
Sites not aligning to the query:
P38820 Adenylyltransferase and sulfurtransferase UBA4; Needs CLA4 to survive protein 3; Ubiquitin-like protein activator 4; EC 2.7.7.-; EC 2.8.1.- from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 4 papers)
34% identity, 97% coverage: 4:360/368 of query aligns to 45:428/440 of P38820
6yubA Crystal structure of uba4 from chaetomium thermophilum (see paper)
33% identity, 98% coverage: 4:364/368 of query aligns to 12:415/423 of 6yubA
6yubB Crystal structure of uba4 from chaetomium thermophilum (see paper)
44% identity, 57% coverage: 4:211/368 of query aligns to 13:212/289 of 6yubB
Sites not aligning to the query:
O95396 Adenylyltransferase and sulfurtransferase MOCS3; Molybdenum cofactor synthesis protein 3; Molybdopterin synthase sulfurylase; MPT synthase sulfurylase; EC 2.7.7.80; EC 2.8.1.11 from Homo sapiens (Human) (see 5 papers)
41% identity, 61% coverage: 5:228/368 of query aligns to 62:281/460 of O95396
Sites not aligning to the query:
D4GSF3 SAMP-activating enzyme E1; Ubiquitin-like activating enzyme of archaea; Ubl-activating enzyme; EC 2.7.7.- from Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) (Halobacterium volcanii) (see paper)
41% identity, 63% coverage: 4:235/368 of query aligns to 11:237/270 of D4GSF3
P12282 Molybdopterin-synthase adenylyltransferase; MoaD protein adenylase; Molybdopterin-converting factor subunit 1 adenylase; Sulfur carrier protein MoaD adenylyltransferase; EC 2.7.7.80 from Escherichia coli (strain K12) (see 2 papers)
39% identity, 61% coverage: 5:229/368 of query aligns to 11:230/249 of P12282
Sites not aligning to the query:
1zfnA Structural analysis of escherichia coli thif (see paper)
45% identity, 57% coverage: 5:214/368 of query aligns to 8:212/244 of 1zfnA
Sites not aligning to the query:
P30138 Sulfur carrier protein ThiS adenylyltransferase; EC 2.7.7.73 from Escherichia coli (strain K12) (see 3 papers)
45% identity, 57% coverage: 5:214/368 of query aligns to 8:212/251 of P30138
Sites not aligning to the query:
1zud3 Structure of this-thif protein complex (see paper)
47% identity, 46% coverage: 5:175/368 of query aligns to 8:175/240 of 1zud3
Sites not aligning to the query:
1jwbB Structure of the covalent acyl-adenylate form of the moeb-moad protein complex (see paper)
37% identity, 61% coverage: 5:229/368 of query aligns to 10:222/240 of 1jwbB
Sites not aligning to the query:
1jw9B Structure of the native moeb-moad protein complex (see paper)
37% identity, 61% coverage: 5:229/368 of query aligns to 10:222/240 of 1jw9B
Sites not aligning to the query:
1jwaB Structure of the atp-bound moeb-moad protein complex (see paper)
36% identity, 61% coverage: 5:229/368 of query aligns to 10:207/217 of 1jwaB
O42939 Ubiquitin-activating enzyme E1-like; Pmt3-activating enzyme subunit 2 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
34% identity, 38% coverage: 18:157/368 of query aligns to 18:158/628 of O42939
Sites not aligning to the query:
O65041 NEDD8-activating enzyme E1 catalytic subunit; RUB-activating enzyme; Ubiquitin-activating enzyme E1-like protein; EC 6.2.1.64 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
38% identity, 35% coverage: 27:154/368 of query aligns to 48:187/454 of O65041
Sites not aligning to the query:
P22314 Ubiquitin-like modifier-activating enzyme 1; Protein A1S9; Ubiquitin-activating enzyme E1; EC 6.2.1.45 from Homo sapiens (Human) (see 2 papers)
32% identity, 42% coverage: 5:157/368 of query aligns to 450:609/1058 of P22314
Sites not aligning to the query:
6dc6C Crystal structure of human ubiquitin activating enzyme e1 (uba1) in complex with ubiquitin (see paper)
32% identity, 42% coverage: 5:157/368 of query aligns to 402:561/996 of 6dc6C
Sites not aligning to the query:
5um6A Crystal structure of s. Pombe uba1 in a closed conformation (see paper)
32% identity, 44% coverage: 5:167/368 of query aligns to 373:542/962 of 5um6A
Sites not aligning to the query:
>CA265_RS12640 FitnessBrowser__Pedo557:CA265_RS12640
MSAERYNRQIILKGFGEEAQQKLLRAKVLVIGAGGLGCPALQYLAAAGIGHIGIVDDDTI
SLSNLHRQILFTTADIGKLKVEVAAKRLQEMNTQIGIIRHPIRLQKNNILDIVSRYDYIL
DGTDNFESRYLINDACALLNKPLIFAAVSGFEGQLAIFNAPDHLTPSTNYRDLFPIPPDK
GEVANCAENGIIGVLPGILGTMAAAETIKLIAKIGQALTNKILSYNLLTQEQYTINISHG
GGYTLPKTVDEFLNMDYQDTSEGPQGYIEIDAGELVKLQQLESTILIDVRERHEVPILDK
QIFTQVPMSEFGAFMSKEFYQKHVVLICQHGIRSVAAAEAMQEKYGDAKKIYSLKGGIVK
CRDHFLRP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory