Comparing CA265_RS13135 FitnessBrowser__Pedo557:CA265_RS13135 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0AB71 Fructose-bisphosphate aldolase class 2; FBP aldolase; FBPA; Fructose-1,6-bisphosphate aldolase; Fructose-bisphosphate aldolase class II; Sedoheptulose bisphosphate aldolase; EC 4.1.2.13 from Escherichia coli (strain K12) (see 11 papers)
67% identity, 97% coverage: 8:355/359 of query aligns to 11:358/359 of P0AB71
Sites not aligning to the query:
1dosA Structure of fructose-bisphosphate aldolase (see paper)
67% identity, 97% coverage: 8:355/359 of query aligns to 10:357/358 of 1dosA
3qm3A 1.85 angstrom resolution crystal structure of fructose-bisphosphate aldolase (fba) from campylobacter jejuni
65% identity, 97% coverage: 8:356/359 of query aligns to 11:350/350 of 3qm3A
1b57A Class ii fructose-1,6-bisphosphate aldolase in complex with phosphoglycolohydroxamate (see paper)
65% identity, 97% coverage: 8:355/359 of query aligns to 10:345/346 of 1b57A
5vjeA Class ii fructose-1,6-bisphosphate aldolase of escherichia coli with d-glucitol 1,6-bisphosphate (see paper)
63% identity, 97% coverage: 8:355/359 of query aligns to 10:338/339 of 5vjeA
5gk5C Apo structure of fructose 1,6-bisphosphate aldolase from escherichia coli at 1.9 angstrom resolution
62% identity, 97% coverage: 8:355/359 of query aligns to 10:334/335 of 5gk5C
1gynA Class ii fructose 1,6-bisphosphate aldolase with cadmium (not zinc) in the active site (see paper)
61% identity, 97% coverage: 8:355/359 of query aligns to 10:332/333 of 1gynA
P36580 Fructose-bisphosphate aldolase; FBP aldolase; FBPA; Fructose-1,6-bisphosphate aldolase; EC 4.1.2.13 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
54% identity, 97% coverage: 8:354/359 of query aligns to 10:356/358 of P36580
7rgnA Crystal structure of putative fructose-1,6-bisphosphate aldolase from candida auris
50% identity, 97% coverage: 8:354/359 of query aligns to 9:338/340 of 7rgnA
7v6gB Structure of candida albicans fructose-1,6-bisphosphate aldolase mutation c157s with cn39
51% identity, 95% coverage: 8:348/359 of query aligns to 9:330/338 of 7v6gB
Sites not aligning to the query:
7yvaB Crystal structure of candida albicans fructose-1,6-bisphosphate aldolase complexed with lipoic acid
50% identity, 95% coverage: 8:348/359 of query aligns to 9:328/336 of 7yvaB
Sites not aligning to the query:
7v6fA Structure of candida albicans fructose-1,6-bisphosphate aldolase complexed with g3p
50% identity, 95% coverage: 8:348/359 of query aligns to 9:327/335 of 7v6fA
4delA Active site loop dynamics of a class iia fructose 1,6-bisphosphate aldolase from m. Tuberculosis (see paper)
42% identity, 94% coverage: 17:352/359 of query aligns to 10:336/345 of 4delA
Sites not aligning to the query:
3ekzA Structural characterization of tetrameric mycobacterium tuberculosis fructose 1,6-bisphosphate aldolase - substrate binding and catalysis mechanism of a class iia bacterial aldolase (see paper)
41% identity, 94% coverage: 17:352/359 of query aligns to 10:325/334 of 3ekzA
Sites not aligning to the query:
4a22A Structure of mycobacterium tuberculosis fructose 1,6-bisphosphate aldolase bound to n-(4-hydroxybutyl)- glycolohydroxamic acid bis- phosphate (see paper)
40% identity, 94% coverage: 17:352/359 of query aligns to 10:323/329 of 4a22A
3elfA Structural characterization of tetrameric mycobacterium tuberculosis fructose 1,6-bisphosphate aldolase - substrate binding and catalysis mechanism of a class iia bacterial aldolase (see paper)
40% identity, 94% coverage: 17:352/359 of query aligns to 10:323/332 of 3elfA
Sites not aligning to the query:
4lv4A A noncompetitive inhibitor for m. Tuberculosis's class iia fructose 1, 6-bisphosphate aldolase (see paper)
37% identity, 94% coverage: 17:352/359 of query aligns to 10:311/320 of 4lv4A
Sites not aligning to the query:
8q5aA Crystal structure of metal-dependent class ii sulfofructosephosphate aldolase from hafnia paralvei hpsqia-zn in complex with dihydroxyacetone phosphate (dhap) (see paper)
28% identity, 79% coverage: 18:299/359 of query aligns to 9:237/276 of 8q5aA
3q94A The crystal structure of fructose 1,6-bisphosphate aldolase from bacillus anthracis str. 'Ames ancestor'
26% identity, 91% coverage: 14:339/359 of query aligns to 5:268/285 of 3q94A
8q59A Crystal structure of metal-dependent class ii sulfofructose phosphate aldolase from yersinia aldovae in complex with sulfofructose phosphate (yasqia-zn-sfp) (see paper)
27% identity, 79% coverage: 18:299/359 of query aligns to 9:237/280 of 8q59A
>CA265_RS13135 FitnessBrowser__Pedo557:CA265_RS13135
MSLKGYKGVIYGDAVQELFEQAKKHQFALPAVNVTGTNTVNAVLETAKAVNSPVMIQLSN
GGAQFYAGKSLDNEKLQACILGAVSAAKHVHLLAEHYGVAVVLHTDHAAKKLLPWIDGLL
DHGEKFFAETGKPLFSSHMLDLSEESIEENMEISAKYLARMAKMNMTIEIELGVTGGEED
GVDNSDVDSSKLYTQPSEVAYAYEELSKVSPRFTVAAAFGNVHGVYKPGNVKLQPVILKN
SQDFIKEKFSLTAEKPINFVFHGGSGSTQEEIREAISYGAIKMNIDTDMQWAFWEGILEY
YKKNEAYLQGQIGNPDGDDKPNKKYYDPRVWLRKGEETFVKRLTTAFEDLNCINVNDKL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory