SitesBLAST
Comparing CA265_RS13185 FitnessBrowser__Pedo557:CA265_RS13185 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1wqaA Crystal structure of pyrococcus horikoshii phosphomannomutase/phosphoglucomutase complexed with mg2+
38% identity, 95% coverage: 12:449/461 of query aligns to 6:444/455 of 1wqaA
- active site: R11 (= R17), S101 (= S104), H102 (= H105), K111 (= K114), D243 (= D249), D245 (= D251), D247 (= D253), R248 (= R254), G330 (= G335), R340 (= R345)
- binding magnesium ion: S101 (= S104), D243 (= D249), D245 (= D251), D247 (= D253)
4il8A Crystal structure of an h329a mutant of p. Aeruginosa pmm/pgm (see paper)
30% identity, 97% coverage: 14:458/461 of query aligns to 15:451/459 of 4il8A
- active site: R16 (≠ G15), S104 (= S104), H105 (= H105), K114 (= K114), D238 (= D249), D240 (= D251), D242 (= D253), R243 (= R254), A325 (≠ G335), D336 (≠ R345)
- binding magnesium ion: S104 (= S104), D238 (= D249), D240 (= D251), D242 (= D253)
P26276 Phosphomannomutase/phosphoglucomutase; PMM / PGM; EC 5.4.2.2; EC 5.4.2.8 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see 10 papers)
30% identity, 97% coverage: 14:458/461 of query aligns to 19:455/463 of P26276
- R20 (≠ G15) mutation to A: No phosphoglucomutase activity.
- S108 (= S104) binding via phosphate group; modified: Phosphoserine; mutation S->A,V: About 5% activity, still subject to substrate inhibition and requires G1,6P as an activator; phosphorylation occurs at a different site.; mutation to C: KM for G1P unchanged, kcat decreases 24-fold; G1,6P stimulates reaction by 2-3 orders of magnitude. No stable protein phosphorylation detected, altered ligation of metal residue.
- N110 (= N106) mutation to A: KM halves, decreases processivity as dissociation of G1,6P intermediate increases 30-fold.
- D242 (= D249) binding
- D244 (= D251) binding
- D246 (= D253) binding
- R247 (= R254) mutation to A: Small reduction in KM, small increase in dissociation of G1,6P intermediate.
- R262 (≠ Y269) mutation to A: Increases KM 2-fold, decreases kcat 9-fold for G1P. Alters flexibility of the hinge region.
- K285 (≠ S291) binding
- H308 (≠ E314) binding ; binding
- E325 (= E331) mutation to A: Reduces KM and Vmax approximately 2-fold.
- EMSGH 325:329 (≠ EGNGG 331:335) binding ; binding
- H329 (≠ G335) mutation to A: No phosphoglucomutase activity using G1P as substrate, protein is less easily phosphorylated, no significant change in structure.
- P368 (= P373) mutation to G: Increases KM 2-fold, decreases kcat 6-fold for G1P. Alters flexibility of the hinge region, structure is less compact.
- R421 (= R424) mutation to C: Loss of phosphomannomutase activity, very low phosphoglucomutase activity.
- RASNT 421:425 (≠ RRSNT 424:428) binding ; binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 15 R→A: KM halves, decreases processivity as dissociation of G1,6P intermediate increases 25-fold.
- 17 binding ; binding
Q02E40 Phosphomannomutase/phosphoglucomutase; PMM / PGM; EC 5.4.2.2; EC 5.4.2.8 from Pseudomonas aeruginosa (strain UCBPP-PA14) (see paper)
30% identity, 97% coverage: 14:458/461 of query aligns to 19:455/463 of Q02E40
- S108 (= S104) active site, Non-phosphorylated intermediate; modified: Phosphoserine
2h5aX Complex of the enzyme pmm/pgm with xylose 1-phosphate (see paper)
30% identity, 97% coverage: 14:458/461 of query aligns to 11:447/455 of 2h5aX
- active site: H101 (= H105), D234 (= D249), D236 (= D251), D238 (= D253), R239 (= R254), D332 (≠ R345)
- binding 1-O-phosphono-alpha-D-xylopyranose: T298 (≠ V312), G299 (= G313), H300 (≠ E314), E317 (= E331), S319 (≠ N333), H321 (≠ G335), R413 (= R424), S415 (= S426), N416 (= N427), T417 (= T428)
- binding zinc ion: S100 (= S104), D234 (= D249), D236 (= D251), D238 (= D253)
Sites not aligning to the query:
2h4lX Complex of pmm/pgm with ribose 1-phosphate (see paper)
30% identity, 97% coverage: 14:458/461 of query aligns to 11:447/455 of 2h4lX
- active site: H101 (= H105), D234 (= D249), D236 (= D251), D238 (= D253), R239 (= R254), D332 (≠ R345)
- binding 1-O-phosphono-alpha-D-ribofuranose: R12 (≠ G15), S100 (= S104), T298 (≠ V312), E317 (= E331), R413 (= R424), S415 (= S426), N416 (= N427), T417 (= T428)
- binding zinc ion: S100 (= S104), D234 (= D249), D236 (= D251), D238 (= D253)
Sites not aligning to the query:
2fkfA Phosphomannomutase/phosphoglucomutase from pseudomonas aeruginosa with alpha-d-glucose 1,6-bisphosphate bound (see paper)
30% identity, 97% coverage: 14:458/461 of query aligns to 11:447/455 of 2fkfA
- active site: R12 (≠ G15), S100 (= S104), H101 (= H105), K110 (= K114), D234 (= D249), D236 (= D251), D238 (= D253), R239 (= R254), H321 (≠ G335), D332 (≠ R345)
- binding 1,6-di-O-phosphono-alpha-D-glucopyranose: H101 (= H105), S319 (≠ N333), R413 (= R424), S415 (= S426), N416 (= N427), T417 (= T428)
- binding zinc ion: S100 (= S104), D234 (= D249), D236 (= D251), D238 (= D253)
Sites not aligning to the query:
1pcmX Enzyme-ligand complex of p. Aeruginosa pmm/pgm (see paper)
30% identity, 97% coverage: 14:458/461 of query aligns to 11:447/455 of 1pcmX
- active site: R12 (≠ G15), S100 (= S104), H101 (= H105), K110 (= K114), D234 (= D249), D236 (= D251), D238 (= D253), R239 (= R254), H321 (≠ G335), D332 (≠ R345)
- binding 6-O-phosphono-alpha-D-mannopyranose: S100 (= S104), T298 (≠ V312), G299 (= G313), H300 (≠ E314), E317 (= E331), S319 (≠ N333), H321 (≠ G335), R413 (= R424), S415 (= S426)
- binding zinc ion: S100 (= S104), D234 (= D249), D236 (= D251), D238 (= D253)
Sites not aligning to the query:
1p5gX Enzyme-ligand complex of p. Aeruginosa pmm/pgm (see paper)
30% identity, 97% coverage: 14:458/461 of query aligns to 11:447/455 of 1p5gX
- active site: R12 (≠ G15), S100 (= S104), H101 (= H105), K110 (= K114), D234 (= D249), D236 (= D251), D238 (= D253), R239 (= R254), H321 (≠ G335), D332 (≠ R345)
- binding 6-O-phosphono-alpha-D-glucopyranose: S100 (= S104), K277 (≠ S291), G299 (= G313), H300 (≠ E314), E317 (= E331), S319 (≠ N333), H321 (≠ G335), R413 (= R424), S415 (= S426), N416 (= N427), T417 (= T428)
- binding zinc ion: S100 (= S104), D234 (= D249), D236 (= D251), D238 (= D253)
Sites not aligning to the query:
1p5dX Enzyme-ligand complex of p. Aeruginosa pmm/pgm (see paper)
30% identity, 97% coverage: 14:458/461 of query aligns to 11:447/455 of 1p5dX
- active site: R12 (≠ G15), S100 (= S104), H101 (= H105), K110 (= K114), D234 (= D249), D236 (= D251), D238 (= D253), R239 (= R254), H321 (≠ G335), D332 (≠ R345)
- binding 1-O-phosphono-alpha-D-glucopyranose: S100 (= S104), R239 (= R254), T298 (≠ V312), G299 (= G313), H300 (≠ E314), E317 (= E331), S319 (≠ N333), H321 (≠ G335), R413 (= R424), S415 (= S426), T417 (= T428)
- binding zinc ion: S100 (= S104), D234 (= D249), D236 (= D251), D238 (= D253)
Sites not aligning to the query:
1pcjX Enzyme-ligand complex of p. Aeruginosa pmm/pgm (see paper)
30% identity, 97% coverage: 14:458/461 of query aligns to 14:450/458 of 1pcjX
- active site: R15 (≠ G15), S103 (= S104), H104 (= H105), K113 (= K114), D237 (= D249), D239 (= D251), D241 (= D253), R242 (= R254), H324 (≠ G335), D335 (≠ R345)
- binding 1-O-phosphono-alpha-D-mannopyranose: S103 (= S104), T301 (≠ V312), G302 (= G313), E320 (= E331), S322 (≠ N333), H324 (≠ G335), R416 (= R424), S418 (= S426), N419 (= N427), T420 (= T428)
- binding zinc ion: S103 (= S104), D237 (= D249), D239 (= D251), D241 (= D253)
Sites not aligning to the query:
1k2yX Crystal structure of phosphomannomutase/phosphoglucomutase s108a mutant from p. Aeruginosa (see paper)
30% identity, 97% coverage: 14:458/461 of query aligns to 15:451/459 of 1k2yX
3rsmA Crystal structure of s108c mutant of pmm/pgm (see paper)
29% identity, 93% coverage: 30:458/461 of query aligns to 6:428/436 of 3rsmA
- active site: C87 (≠ S104), K91 (= K114), D215 (= D249), D217 (= D251), D219 (= D253), R220 (= R254), H302 (≠ G335), D313 (≠ R345)
- binding phosphate ion: C87 (≠ S104), D215 (= D249), D217 (= D251), D219 (= D253), R220 (= R254)
- binding zinc ion: D215 (= D249), D217 (= D251), D219 (= D253)
6mlwA Crystal structure of x. Citri phosphoglucomutase in complex with 2- fluoro mannosyl-1-methyl-phosphonic acid (see paper)
29% identity, 89% coverage: 47:455/461 of query aligns to 41:446/449 of 6mlwA
- active site: S98 (= S104), H99 (= H105), K108 (= K114), D238 (= D249), D240 (= D251), D242 (= D253), R243 (= R254), H325 (≠ G335)
- binding 2,6-anhydro-5,7-dideoxy-5-fluoro-7-phosphono-D-glycero-D-manno-heptitol: G303 (= G313), H304 (≠ E314), E321 (= E331), S323 (≠ N333), H325 (≠ G335), R415 (= R424), S417 (= S426), N418 (= N427), T419 (= T428), R424 (= R433)
- binding magnesium ion: S98 (= S104), D238 (= D249), D240 (= D251), D242 (= D253)
Sites not aligning to the query:
5bmpA Crystal structure of phosphoglucomutase from xanthomonas citri complexed with glucose-1-phosphate (see paper)
29% identity, 89% coverage: 47:455/461 of query aligns to 41:446/449 of 5bmpA
- active site: S98 (= S104), H99 (= H105), K108 (= K114), D238 (= D249), D240 (= D251), D242 (= D253), R243 (= R254), H325 (≠ G335)
- binding 1-O-phosphono-alpha-D-glucopyranose: R281 (≠ S291), G303 (= G313), E321 (= E331), S323 (≠ N333), H325 (≠ G335), R415 (= R424), S417 (= S426), N418 (= N427), T419 (= T428), R424 (= R433)
- binding magnesium ion: S98 (= S104), D238 (= D249), D240 (= D251), D242 (= D253)
Sites not aligning to the query:
6nqhA Xanthomonas citri dephospho-pgm in complex with xylose-1-phosphate
29% identity, 89% coverage: 47:455/461 of query aligns to 40:445/448 of 6nqhA
- active site: S97 (= S104), H98 (= H105), K107 (= K114), D237 (= D249), D239 (= D251), D241 (= D253), R242 (= R254), H324 (≠ G335)
- binding magnesium ion: D237 (= D249), D239 (= D251), D241 (= D253)
- binding 1-O-phosphono-alpha-D-xylopyranose: S97 (= S104), H98 (= H105), K107 (= K114), D239 (= D251), R242 (= R254), R280 (≠ S291), S301 (≠ V312), G302 (= G313), E320 (= E331), S322 (≠ N333), H324 (≠ G335), R414 (= R424), S416 (= S426), N417 (= N427), T418 (= T428), R423 (= R433)
Sites not aligning to the query:
6np8A Xanthomonas citri phospho-pgm in complex with mannose-6-phosphate (see paper)
29% identity, 89% coverage: 47:455/461 of query aligns to 40:445/448 of 6np8A
- active site: S97 (= S104), H98 (= H105), K107 (= K114), D237 (= D249), D239 (= D251), D241 (= D253), R242 (= R254), H324 (≠ G335)
- binding calcium ion: S97 (= S104), D237 (= D249), D239 (= D251), D241 (= D253)
- binding 6-O-phosphono-alpha-D-mannopyranose: R280 (≠ S291), G302 (= G313), H303 (≠ E314), E320 (= E331), S322 (≠ N333), H324 (≠ G335), R414 (= R424), S416 (= S426), N417 (= N427), T418 (= T428), R423 (= R433)
Sites not aligning to the query:
6nolA Xanthomonas citri dephospho-pgm in complex with mannose-1-phosphate (see paper)
29% identity, 89% coverage: 47:455/461 of query aligns to 40:445/448 of 6nolA
- active site: S97 (= S104), H98 (= H105), K107 (= K114), D237 (= D249), D239 (= D251), D241 (= D253), R242 (= R254), H324 (≠ G335)
- binding 1-O-phosphono-alpha-D-mannopyranose: G302 (= G313), E320 (= E331), S322 (≠ N333), H324 (≠ G335), R414 (= R424), S416 (= S426), N417 (= N427), T418 (= T428), R423 (= R433)
- binding magnesium ion: S97 (= S104), D237 (= D249), D239 (= D251), D241 (= D253)
Sites not aligning to the query:
6nnpA Xanthomonas citri dephospho-pgm in complex with glucose-6-phosphate (see paper)
29% identity, 89% coverage: 47:455/461 of query aligns to 40:445/448 of 6nnpA
- active site: S97 (= S104), H98 (= H105), K107 (= K114), D237 (= D249), D239 (= D251), D241 (= D253), R242 (= R254), H324 (≠ G335)
- binding 6-O-phosphono-alpha-D-glucopyranose: R280 (≠ S291), G302 (= G313), H303 (≠ E314), E320 (= E331), H324 (≠ G335), R414 (= R424), S416 (= S426), N417 (= N427), T418 (= T428), R423 (= R433)
- binding magnesium ion: S97 (= S104), D237 (= D249), D239 (= D251), D241 (= D253)
Sites not aligning to the query:
6nn2A Xanthomonas citri pgm apo-phospho (see paper)
29% identity, 89% coverage: 47:455/461 of query aligns to 40:445/448 of 6nn2A
- active site: S97 (= S104), H98 (= H105), K107 (= K114), D237 (= D249), D239 (= D251), D241 (= D253), R242 (= R254), H324 (≠ G335)
- binding calcium ion: S97 (= S104), D237 (= D249), D239 (= D251), D241 (= D253)
Sites not aligning to the query:
Query Sequence
>CA265_RS13185 FitnessBrowser__Pedo557:CA265_RS13185
MTLIKSISGIRGTIGGRAGDGLTPFDIVKFTAAFGSWVVQKTGNKRIVLGRDARISGEMV
NNLVIGTLQGLGIEVIDLGLSTTPTVEVAVPDEKAGGGIILTASHNPKQWNALKLLNASG
EFISDADGKEVLDLAESADFDFADVDKLGKVIKNDTYLQKHIDKVLALPLVDVEAIKKAD
FKVVIDCVNSTGGIFIPALLKALGVSKVVELYCTPDGHFPHNPEPLPENLTEISKEVQKQ
NADLGIVVDPDVDRLCFVNEDGSMFGEEYTLVAVADYVLKNTPGNTVSNLSSTRALRDVT
ESAGAEYNASAVGEVNVVNKMKATNAIIGGEGNGGIIYPESHYGRDALVGIALFLTHLAK
FGKSISVLRSSYPQYHISKNKITLTPEMDIDNLLKQVEEKYKNQPYSTIDGLKIEFDKTW
VHLRRSNTEPIIRIYSEAENETIAENLANKIISDIKEILHL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory