Comparing CA265_RS13580 FitnessBrowser__Pedo557:CA265_RS13580 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8h29A Serine palmitoyltransferase from sphingobacterium multivorum complexed with l-threonine (see paper)
68% identity, 98% coverage: 2:394/401 of query aligns to 2:394/394 of 8h29A
8h21A Serine palmitoyltransferase from sphingobacterium multivorum complexed with l-alanine (see paper)
68% identity, 98% coverage: 2:394/401 of query aligns to 2:394/394 of 8h21A
8h20A Serine palmitoyltransferase from sphingobacterium multivorum complexed with glycine (see paper)
68% identity, 98% coverage: 2:394/401 of query aligns to 2:394/394 of 8h20A
8h1yA Serine palmitoyltransferase from sphingobacterium multivorum complexed with l-homoserine (see paper)
68% identity, 98% coverage: 2:394/401 of query aligns to 2:394/394 of 8h1yA
8h1qA Serine palmitoyltransferase from sphingobacterium multivorum complexed with l-serine (see paper)
68% identity, 98% coverage: 2:394/401 of query aligns to 2:394/394 of 8h1qA
8guhA Serine palmitoyltransferase from sphingobacterium multivorum complexed with tris (see paper)
68% identity, 98% coverage: 2:394/401 of query aligns to 2:394/394 of 8guhA
3a2bA Crystal structure of serine palmitoyltransferase from sphingobacterium multivorum with substrate l-serine (see paper)
69% identity, 97% coverage: 2:390/401 of query aligns to 2:390/392 of 3a2bA
Q5W264 4-hydroxy-2,2'-bipyrrole-5-methanol synthase PigH; HBM synthase; Aminotransferase PigH; EC 2.3.2.- from Serratia sp. (strain ATCC 39006) (see paper)
39% identity, 95% coverage: 19:399/401 of query aligns to 255:641/653 of Q5W264
Sites not aligning to the query:
2xbnA Inhibition of the plp-dependent enzyme serine palmitoyltransferase by cycloserine: evidence for a novel decarboxylative mechanism of inactivation (see paper)
38% identity, 90% coverage: 36:394/401 of query aligns to 37:397/398 of 2xbnA
2w8jA Spt with plp-ser (see paper)
38% identity, 90% coverage: 36:394/401 of query aligns to 37:397/398 of 2w8jA
Sites not aligning to the query:
Q93UV0 Serine palmitoyltransferase; SPT; EC 2.3.1.50 from Sphingomonas paucimobilis (Pseudomonas paucimobilis) (see 4 papers)
38% identity, 90% coverage: 36:394/401 of query aligns to 58:418/420 of Q93UV0
Sites not aligning to the query:
4bmkA Serine palmitoyltransferase k265a from s. Paucimobilis with bound plp- myriocin aldimine (see paper)
37% identity, 90% coverage: 36:394/401 of query aligns to 37:397/398 of 4bmkA
1fc4A 2-amino-3-ketobutyrate coa ligase (see paper)
37% identity, 95% coverage: 14:394/401 of query aligns to 15:399/401 of 1fc4A
P0AB77 2-amino-3-ketobutyrate coenzyme A ligase; AKB ligase; Glycine acetyltransferase; EC 2.3.1.29 from Escherichia coli (strain K12) (see paper)
37% identity, 95% coverage: 14:394/401 of query aligns to 12:396/398 of P0AB77
7v58B Structural insights into the substrate selectivity of acyl-coa transferase (see paper)
37% identity, 91% coverage: 18:382/401 of query aligns to 18:386/400 of 7v58B
2x8uA Sphingomonas wittichii serine palmitoyltransferase (see paper)
37% identity, 90% coverage: 36:394/401 of query aligns to 37:397/399 of 2x8uA
7poaA An irreversible, promiscuous and highly thermostable claisen- condensation biocatalyst drives the synthesis of substituted pyrroles
39% identity, 91% coverage: 18:382/401 of query aligns to 19:384/398 of 7poaA
3tqxA Structure of the 2-amino-3-ketobutyrate coenzyme a ligase (kbl) from coxiella burnetii (see paper)
37% identity, 92% coverage: 13:382/401 of query aligns to 10:383/396 of 3tqxA
7u7hA Cysteate acyl-acp transferase from alistipes finegoldii (see paper)
36% identity, 94% coverage: 24:399/401 of query aligns to 26:405/423 of 7u7hA
7bxsA 2-amino-3-ketobutyrate coa ligase from cupriavidus necator glycine binding form
35% identity, 94% coverage: 18:394/401 of query aligns to 18:398/399 of 7bxsA
>CA265_RS13580 FitnessBrowser__Pedo557:CA265_RS13580
MRKKLQDRIASFKDAAVIKEKGLYPYFRSIESGQDTEVVINGKKVLMFGSNSYLGLTNHP
KIKEAAKAAIEKYGTGCAGSRFLNGSLDIHLELENRLAEYVGKEAAVLFSTGFQVNLGVI
SCLLDRNDYLLLDEYDHASIIDGSRLAFSRTIKYAHNDMQDLRRKLSRLPEDSAKLIVSD
GIFSMEGDLVNLPEMVDIANEFGANIMMDDAHSLGVIGFNGSGTASHFNLTEDVDLIMGT
FSKSLASLGGFIAGSTETIEYIKHRARSLMFSASMPPSAVASVIAALDIIESEPERIDKL
WANTEYAKKLLLEAGFDIGHSNSPIIPVYIRDNIKTFMITNILQQNGVFVNPVVSPAVPS
DSSLIRFSLMATHTFEQIESAIAKLSAAFKAVNVELVGSQS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory