SitesBLAST
Comparing CA265_RS13660 FitnessBrowser__Pedo557:CA265_RS13660 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6ixmC Crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. Ca49 complexed with NAD (see paper)
33% identity, 96% coverage: 7:258/262 of query aligns to 3:248/248 of 6ixmC
- active site: G16 (= G20), S142 (= S147), Y155 (= Y160), K159 (= K164)
- binding nicotinamide-adenine-dinucleotide: G12 (= G16), S15 (= S19), G16 (= G20), I17 (= I21), D36 (≠ E41), I37 (≠ Q42), A61 (= A68), D62 (= D69), T63 (≠ M70), N89 (= N96), A90 (= A97), M140 (= M145), S142 (= S147), Y155 (= Y160), K159 (= K164), P185 (= P189), A186 (≠ G190), Y187 (≠ F191), I188 (= I192), L192 (≠ W200)
Q9BTZ2 Dehydrogenase/reductase SDR family member 4; NADPH-dependent carbonyl reductase; CR; NADPH-dependent retinol dehydrogenase/reductase; NRDR; humNRDR; Peroxisomal short-chain alcohol dehydrogenase; PSCD; SCAD-SRL; Short chain dehydrogenase/reductase family 25C member 2; Protein SDR25C2; Short-chain dehydrogenase/reductase family member 4; EC 1.1.1.184 from Homo sapiens (Human) (see 2 papers)
34% identity, 95% coverage: 7:254/262 of query aligns to 30:273/278 of Q9BTZ2
- S176 (≠ I154) Responsible for the stereoselective reduction of 3-ketosteroids into 3beta-hydroxysteroids and benzil into R-benzoin; mutation to F: Decreased reduction activity for benzil, isatin and retinal and increased activity for 5beta-Pregnane-3,20-dione and 5beta-Dihydrotestosterone. No change of stereoselectivity in 3-ketosteroids reduction and no change in 3beta-hydroxysteroid oxidation. Decreased reduction activity for isatin and increased activity for 5beta-Pregnane-3,20-dione, 5beta-Dihydrotestosterone, benzil and retinal; when associated with L-179. Change in stereoselective activity by the reduction of 5beta-Pregnane-3,20-dione predominantly to the 3alpha-hydroxysteroid; when associated with L-179. Switch from 3beta-hydroxysteroid to 3alpha-hydroxysteroid oxidation; when associated with L-179. Loss of cold catalytic inactivation; when associated with L-179 and N-195. Increased reduction activity for renital and oxidation activity for retinol; when associated with L-179 and N-195.
- F179 (≠ C157) Responsible for the stereoselective reduction of 3-ketosteroids into 3beta-hydroxysteroids and benzil into R-benzoin; mutation to L: Decreased reduction activity for isatin and increased activity for 5beta-Pregnane-3,20-dione, 5beta-Dihydrotestosterone, benzil and retinal; when associated with F-176. Change in stereoselective activity by the reduction of 5beta-Pregnane-3,20-dione predominantly to the 3alpha-hydroxysteroid; when associated with F-176. Switch from 3beta-hydroxysteroid to 3alpha-hydroxysteroid oxidation; when associated with F-176. Loss of cold catalytic inactivation; when associated with F-176 and N-195. Increased reduction activity for renital and oxidation activity for retinol; when associated with F-176 and N-195.
- T195 (≠ S173) mutation to N: Loss of cold catalytic inactivation. Loss of cold catalytic inactivation; when associated with F-176 and L-179. Switch in stereoselective activity from 3beta-hydroxysteroid to 3alpha-hydroxysteroid oxidation; when associated with F-176 and L-179. Increased reduction activity for renital and oxidation activity for retinol; when associated with F-176 and L-179.
3o4rA Crystal structure of human dehydrogenase/reductase (sdr family) member 4 (dhrs4)
34% identity, 95% coverage: 7:254/262 of query aligns to 6:249/254 of 3o4rA
- active site: G19 (= G20), S145 (= S147), F155 (≠ C157), Y158 (= Y160), K162 (= K164), K203 (≠ S203)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A15 (≠ G16), T17 (= T18), D18 (≠ S19), G19 (= G20), I20 (= I21), S39 (≠ A40), R40 (≠ E41), K41 (≠ Q42), N44 (≠ T45), H65 (≠ D69), V66 (≠ M70), N92 (= N96), A94 (≠ G98), S145 (= S147), Y158 (= Y160), K162 (= K164), P188 (= P189), G189 (= G190), L190 (≠ F191), I191 (= I192), T193 (= T194), F195 (≠ G196), S196 (≠ N197)
4urfB Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
34% identity, 95% coverage: 7:254/262 of query aligns to 3:244/248 of 4urfB
- active site: G16 (= G20), S142 (= S147), I152 (≠ C157), Y155 (= Y160), K159 (= K164)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: L210 (≠ V220), R211 (≠ K221), R212 (≠ K222)
- binding bicarbonate ion: I92 (vs. gap), G94 (≠ N100), R109 (≠ F115), R179 (= R183), S228 (= S238)
- binding nicotinamide-adenine-dinucleotide: G12 (= G16), G14 (≠ T18), N15 (≠ S19), G16 (= G20), I17 (= I21), D36 (≠ E44), I37 (≠ T45), D62 (= D69), T63 (≠ M70), N89 (= N96), A90 (= A97), G91 (= G98), I140 (≠ M145), Y155 (= Y160), K159 (= K164), P185 (= P189), A186 (≠ G190), I188 (= I192), T190 (= T194)
4urfA Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
34% identity, 95% coverage: 7:254/262 of query aligns to 3:244/248 of 4urfA
- active site: G16 (= G20), S142 (= S147), I152 (≠ C157), Y155 (= Y160), K159 (= K164)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: I92 (vs. gap), S93 (≠ Q99), G94 (≠ N100), E95 (≠ V101), T97 (= T103), E101 (≠ N107), T103 (= T109), Q106 (≠ N112), R109 (≠ F115), S175 (vs. gap), G177 (= G181)
- binding magnesium ion: S237 (≠ T247), Y238 (≠ T248)
- binding nicotinamide-adenine-dinucleotide: G12 (= G16), G14 (≠ T18), N15 (≠ S19), G16 (= G20), I17 (= I21), D36 (≠ E44), I37 (≠ T45), W41 (vs. gap), D62 (= D69), T63 (≠ M70), N89 (= N96), A90 (= A97), G91 (= G98), I140 (≠ M145), Y155 (= Y160), K159 (= K164), P185 (= P189), I188 (= I192), T190 (= T194)
4ureB Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
34% identity, 95% coverage: 7:254/262 of query aligns to 3:244/248 of 4ureB
- active site: G16 (= G20), S142 (= S147), I152 (≠ C157), Y155 (= Y160), K159 (= K164)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: N15 (≠ S19), G16 (= G20), I17 (= I21), N89 (= N96), G91 (= G98), Y155 (= Y160), P185 (= P189), A186 (≠ G190)
2zatA Crystal structure of a mammalian reductase (see paper)
32% identity, 97% coverage: 7:259/262 of query aligns to 3:251/251 of 2zatA
- active site: G16 (= G20), S142 (= S147), L152 (≠ C157), Y155 (= Y160), K159 (= K164), K200 (≠ F204)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A12 (≠ G16), T14 (= T18), D15 (≠ S19), G16 (= G20), I17 (= I21), S36 (≠ A40), R37 (≠ E41), K38 (≠ Q42), N41 (≠ T45), H62 (≠ D69), N89 (= N96), A91 (≠ G98), V140 (≠ M145), S142 (= S147), Y155 (= Y160), K159 (= K164), P185 (= P189), G186 (= G190), I188 (= I192), T190 (= T194), F192 (≠ G196), S193 (≠ N197)
Q8WNV7 Dehydrogenase/reductase SDR family member 4; NADPH-dependent carbonyl reductase; CR; PHCR; NADPH-dependent retinol dehydrogenase/reductase; NDRD; Peroxisomal carbonyl reductase; PerCR; Peroxisomal short-chain alcohol dehydrogenase; PSCD; Short chain dehydrogenase/reductase family 25C member 2; Protein SDR25C2; EC 1.1.1.184; EC 1.1.1.300 from Sus scrofa (Pig) (see 2 papers)
32% identity, 97% coverage: 7:259/262 of query aligns to 31:279/279 of Q8WNV7
- 37:61 (vs. 13:37, 52% identical) binding
- F177 (≠ I154) Responsible for the stereoselective reduction of 3-ketosteroids into 3alpha-hydroxysteroids and benzil into S-benzoin; mutation to S: Change in stereoselective activity by the reduction of 3-ketosteroids and benzil into 3beta-hydroxysteroid and R-benzoin, respectively; when associated with F-180.
- L180 (≠ C157) Responsible for the stereoselective reduction of 3-ketosteroids into 3alpha-hydroxysteroids and benzil into S-benzoin; mutation to F: Change in stereoselective activity by the reduction of 3-ketosteroids and benzil into 3beta-hydroxysteroid and R-benzoin, respectively; when associated with S-177.
- Y183 (= Y160) active site, Proton acceptor
- K187 (= K164) binding
- N196 (≠ S173) Important for the maintenance of the quaternary structure, the catalytic activity and cold stability
- SRL 277:279 (≠ AMM 257:259) Peroxisomal targeting signal
1vl8B Crystal structure of gluconate 5-dehydrogenase (tm0441) from thermotoga maritima at 2.07 a resolution
30% identity, 97% coverage: 4:257/262 of query aligns to 1:251/252 of 1vl8B
- active site: G17 (= G20), S143 (≠ A146), I154 (≠ C157), Y157 (= Y160), K161 (= K164)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G16), R16 (≠ S19), G17 (= G20), L18 (≠ I21), S37 (≠ A40), R38 (≠ E41), C63 (≠ A68), D64 (= D69), V65 (≠ M70), A91 (≠ N96), A92 (= A97), G93 (= G98), I94 (≠ Q99), V114 (≠ L119), I141 (≠ V144), S143 (≠ A146), Y157 (= Y160), K161 (= K164), P187 (= P189), G188 (= G190), Y190 (≠ I192), T192 (= T194), M194 (≠ G196), T195 (≠ N197)
6jhbB Crystal structure of NADPH and 4-hydroxyphenylpyruvic acid bound aerf from microcystis aeruginosa (see paper)
29% identity, 97% coverage: 3:257/262 of query aligns to 1:263/264 of 6jhbB
- active site: G18 (= G20), S160 (≠ Y160)
- binding 3-(4-hydroxy-phenyl)pyruvic acid: G147 (≠ S147), S149 (≠ H149), L157 (≠ C157), S160 (≠ Y160), N164 (≠ K164)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G14 (= G16), S16 (≠ T18), A17 (≠ S19), G18 (= G20), I19 (= I21), G38 (≠ A40), R39 (≠ E41), N40 (≠ Q42), A65 (= A68), D66 (= D69), V67 (≠ M70), H68 (≠ V71), N93 (= N96), S94 (≠ A97), E95 (vs. gap), K119 (≠ N120), I145 (≠ M145), I146 (≠ A146), P190 (= P189), I193 (= I192), T195 (= T194), P196 (= P195), R197 (≠ G196)
2ztlA Closed conformation of d-3-hydroxybutyrate dehydrogenase complexed with NAD+ and l-3-hydroxybutyrate (see paper)
34% identity, 96% coverage: 7:257/262 of query aligns to 2:259/260 of 2ztlA
- active site: G15 (= G20), N114 (= N120), S142 (= S147), Y155 (= Y160), K159 (= K164), L200 (vs. gap)
- binding (3s)-3-hydroxybutanoic acid: Q94 (≠ N100), S142 (= S147), H144 (= H149), K152 (≠ C157), Y155 (= Y160), Q196 (≠ W200)
- binding nicotinamide-adenine-dinucleotide: G11 (= G16), G15 (= G20), I16 (= I21), F36 (≠ C39), L64 (≠ M70), N90 (= N96), A91 (= A97), G92 (= G98), L113 (= L119), Y155 (= Y160), K159 (= K164), P185 (= P189), W187 (≠ F191), V188 (≠ I192), T190 (= T194), V193 (≠ N197)
1wmbA Crystal structure of NAD dependent d-3-hydroxybutylate dehydrogenase (see paper)
34% identity, 96% coverage: 7:257/262 of query aligns to 2:259/260 of 1wmbA
Q9KJF1 (2S)-[(R)-hydroxy(phenyl)methyl]succinyl-CoA dehydrogenase subunit BbsD; (S,R)-2-(alpha-hydroxybenzyl)succinyl-CoA dehydrogenase subunit BbsD; EC 1.1.1.429 from Thauera aromatica (see 2 papers)
30% identity, 95% coverage: 7:256/262 of query aligns to 3:244/248 of Q9KJF1
- S15 (= S19) binding
- D36 (= D47) binding
- D62 (= D69) binding
- I63 (≠ M70) binding
- N89 (= N96) binding
- Y153 (= Y160) binding
- K157 (= K164) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
3ai2A The crystal structure of l-sorbose reductase from gluconobacter frateurii complexed with NADPH (see paper)
31% identity, 96% coverage: 3:254/262 of query aligns to 1:258/263 of 3ai2A
- active site: G18 (= G20), S144 (= S147), Y157 (= Y160), K161 (= K164)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G14 (= G16), S16 (≠ T18), S17 (= S19), G18 (= G20), I19 (= I21), A38 (= A40), R39 (≠ E41), Q40 (= Q42), V64 (≠ A68), D65 (= D69), V66 (≠ M70), N92 (= N96), G94 (= G98), N142 (≠ M145), Y157 (= Y160), K161 (= K164), P187 (= P189), I190 (= I192), T192 (= T194), W195 (= W200)
7pcsB Structure of the heterotetrameric sdr family member bbscd (see paper)
30% identity, 95% coverage: 7:256/262 of query aligns to 2:243/247 of 7pcsB
- binding nicotinamide-adenine-dinucleotide: G11 (= G16), M16 (≠ I21), D35 (= D47), I36 (≠ V48), I62 (≠ M70), N88 (= N96), G90 (= G98), I138 (≠ A146), S140 (≠ N148), Y152 (= Y160), K156 (= K164), I185 (= I192)
6jhaA Crystal structure of NADPH bound aerf from microcystis aeruginosa (see paper)
30% identity, 97% coverage: 3:257/262 of query aligns to 1:240/242 of 6jhaA
- active site: G18 (= G20), S145 (≠ Y160)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G14 (= G16), S16 (≠ T18), I19 (= I21), G38 (≠ A40), R39 (≠ E41), N40 (≠ Q42), D66 (= D69), V67 (≠ M70), N93 (= N96), S94 (≠ A97), E95 (≠ G98), K114 (≠ N120), I140 (= I154), L142 (≠ C157), P175 (= P189), T180 (= T194), R182 (≠ G196)
4i08A Crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg) from vibrio cholerae in complex with NADPH (see paper)
31% identity, 95% coverage: 5:254/262 of query aligns to 4:239/243 of 4i08A
- active site: G19 (= G20), N113 (= N120), S141 (= S147), Q151 (≠ C157), Y154 (= Y160), K158 (= K164)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G15 (= G16), S17 (≠ T18), R18 (≠ S19), I20 (= I21), T40 (≠ E41), N62 (≠ D69), V63 (≠ M70), N89 (= N96), A90 (= A97), G140 (≠ A146), S141 (= S147), Y154 (= Y160), K158 (= K164), P184 (= P189), G185 (= G190), T189 (= T194)
3ai3C The crystal structure of l-sorbose reductase from gluconobacter frateurii complexed with NADPH and l-sorbose (see paper)
31% identity, 96% coverage: 3:254/262 of query aligns to 1:258/263 of 3ai3C
- active site: G18 (= G20), S144 (= S147), Y157 (= Y160), K161 (= K164)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G14 (= G16), S16 (≠ T18), S17 (= S19), G18 (= G20), I19 (= I21), A38 (= A40), R39 (≠ E41), Q40 (= Q42), R43 (≠ T45), D65 (= D69), V66 (≠ M70), N92 (= N96), G94 (= G98), N142 (≠ M145), Y157 (= Y160), K161 (= K164), P187 (= P189), G188 (= G190), I190 (= I192), T192 (= T194), W195 (= W200)
- binding alpha-L-sorbopyranose: A252 (≠ T248), F254 (≠ L250)
- binding L-sorbose: G96 (≠ N100), E154 (≠ C157), Y157 (= Y160), W195 (= W200)
Sites not aligning to the query:
3ai3A The crystal structure of l-sorbose reductase from gluconobacter frateurii complexed with NADPH and l-sorbose (see paper)
31% identity, 96% coverage: 3:254/262 of query aligns to 1:258/263 of 3ai3A
- active site: G18 (= G20), S144 (= S147), Y157 (= Y160), K161 (= K164)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G14 (= G16), S16 (≠ T18), S17 (= S19), G18 (= G20), I19 (= I21), A38 (= A40), R39 (≠ E41), Q40 (= Q42), R43 (≠ T45), V64 (≠ A68), D65 (= D69), V66 (≠ M70), N92 (= N96), G94 (= G98), N142 (≠ M145), S144 (= S147), Y157 (= Y160), K161 (= K164), P187 (= P189), G188 (= G190), I190 (= I192), T192 (= T194), W195 (= W200)
- binding L-sorbose: G96 (≠ N100), S144 (= S147), L151 (≠ I154), E154 (≠ C157), Y157 (= Y160), G188 (= G190)
3op4A Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. N16961 in complex with NADP+ (see paper)
30% identity, 95% coverage: 5:254/262 of query aligns to 4:243/247 of 3op4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G16), S17 (≠ T18), R18 (≠ S19), I20 (= I21), T40 (≠ E41), N62 (≠ D69), V63 (≠ M70), N89 (= N96), A90 (= A97), I92 (≠ Q99), V139 (≠ M145), S141 (= S147), Y154 (= Y160), K158 (= K164), P184 (= P189), G185 (= G190), I187 (= I192), T189 (= T194), M191 (≠ G196)
Query Sequence
>CA265_RS13660 FitnessBrowser__Pedo557:CA265_RS13660
MALTIDLKGKIALVTGVTSGIGLGIAKMMAKAGCTVIGCAEQSETSDVAQRFLAEMESFD
AHTDYFKADMVVTEDIDGLVSDITNDYGRLDILVSNAGQNVFTGLENSTEKNWQFNLDLN
LSAHWRLAKRCKSLLNTNNGVIIVMASNHAFASIPGCAPYNIAKTALTGLVRSLAIEWGP
GIRTIGIAPGFIDTPGNQQWFNSFIQPEEERQRTINLHPVKKLGTVEEIGGWCVFLSSEY
AGFASGTTYLIDGGRSAMMQDS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory