SitesBLAST
Comparing CA265_RS13715 CA265_RS13715 glucose dehydrogenase to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
36% identity, 96% coverage: 5:243/248 of query aligns to 9:254/255 of 5itvA
- active site: G18 (= G14), S141 (≠ T138), Y154 (vs. gap), K158 (= K157)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G10), S17 (≠ T13), G18 (= G14), I19 (= I15), D38 (≠ S34), I39 (≠ A35), T61 (≠ G58), I63 (= I60), N89 (= N86), G91 (= G88), T139 (≠ I136), S141 (≠ T138), Y154 (vs. gap), K158 (= K157), P184 (= P183), G185 (= G184), I186 (= I185), I187 (= I186)
Q9KJF1 (2S)-[(R)-hydroxy(phenyl)methyl]succinyl-CoA dehydrogenase subunit BbsD; (S,R)-2-(alpha-hydroxybenzyl)succinyl-CoA dehydrogenase subunit BbsD; EC 1.1.1.429 from Thauera aromatica (see 2 papers)
34% identity, 95% coverage: 7:241/248 of query aligns to 9:243/248 of Q9KJF1
- S15 (≠ T13) binding
- D36 (≠ S34) binding
- D62 (= D59) binding
- I63 (= I60) binding
- N89 (= N86) binding
- Y153 (≠ P153) binding
- K157 (= K157) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
7pcsB Structure of the heterotetrameric sdr family member bbscd (see paper)
34% identity, 95% coverage: 7:241/248 of query aligns to 8:242/247 of 7pcsB
- binding nicotinamide-adenine-dinucleotide: G11 (= G10), M16 (≠ I15), D35 (≠ S34), I36 (≠ A35), I62 (= I60), N88 (= N86), G90 (= G88), I138 (= I136), S140 (≠ T138), Y152 (≠ P153), K156 (= K157), I185 (= I186)
7krmC Putative fabg bound to nadh from acinetobacter baumannii
36% identity, 94% coverage: 7:240/248 of query aligns to 9:240/244 of 7krmC
- active site: G18 (= G14), S140 (≠ T138), Y155 (≠ P153)
- binding nicotinamide-adenine-dinucleotide: G12 (= G10), S15 (≠ T13), G18 (= G14), I19 (= I15), D38 (≠ S34), L39 (≠ A35), A60 (≠ G58), N61 (≠ D59), V62 (≠ I60), N88 (= N86), V111 (≠ I109), S140 (≠ T138), Y155 (≠ P153), K159 (= K157), I188 (= I186), T190 (≠ S188)
6ixmC Crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. Ca49 complexed with NAD (see paper)
34% identity, 96% coverage: 7:243/248 of query aligns to 9:247/248 of 6ixmC
- active site: G16 (= G14), S142 (≠ T138), Y155 (≠ P153), K159 (= K157)
- binding nicotinamide-adenine-dinucleotide: G12 (= G10), S15 (≠ T13), G16 (= G14), I17 (= I15), D36 (≠ S34), I37 (≠ A35), A61 (≠ G58), D62 (= D59), T63 (≠ I60), N89 (= N86), A90 (= A87), M140 (≠ I136), S142 (≠ T138), Y155 (≠ P153), K159 (= K157), P185 (= P183), A186 (≠ G184), Y187 (≠ I185), I188 (= I186), L192 (= L190)
8cxaA Crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase from mycobacterium smegmatis with bound NAD
39% identity, 94% coverage: 7:240/248 of query aligns to 9:247/251 of 8cxaA
- binding nicotinamide-adenine-dinucleotide: G12 (= G10), Q15 (≠ T13), G16 (= G14), I17 (= I15), D36 (≠ S34), V63 (≠ I60), N89 (= N86), A91 (≠ G88), S94 (≠ E91), I142 (= I136), S143 (≠ G137), S144 (≠ T138), Y157 (≠ P153), K161 (= K157), P187 (= P183), H188 (vs. gap), I190 (= I185), I194 (vs. gap)
7v0hG Crystal structure of putative glucose 1-dehydrogenase from burkholderia cenocepacia in complex with NADP and a potential reaction product
37% identity, 94% coverage: 7:240/248 of query aligns to 15:251/253 of 7v0hG
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G10), S20 (= S12), K21 (≠ T13), G22 (= G14), I23 (= I15), A43 (= A35), S44 (≠ N36), S45 (≠ E37), G68 (= G58), D69 (= D59), V70 (≠ I60), N96 (= N86), S97 (≠ A87), G98 (= G88), Y100 (≠ F90), I144 (= I136), S146 (≠ T138), Y159 (≠ I154), K163 (= K157), P189 (= P183), G190 (= G184), M191 (≠ I185), I192 (= I186), T194 (≠ S188), G196 (≠ L190), T197 (≠ Q191)
- binding (2R)-2-(hydroxymethyl)pentanedioic acid: S146 (≠ T138), Y159 (≠ I154), M191 (≠ I185), I202 (= I196)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
34% identity, 95% coverage: 7:242/248 of query aligns to 9:246/247 of 4jroC
- active site: G16 (= G14), S142 (≠ T138), Q152 (≠ A150), Y155 (≠ P153), K159 (= K157)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G10), S14 (= S12), R15 (≠ T13), G16 (= G14), I17 (= I15), N35 (= N33), Y36 (≠ S34), N37 (≠ A35), G38 (≠ N36), S39 (≠ E37), N63 (≠ D59), V64 (≠ I60), N90 (= N86), A91 (= A87), I93 (= I89), I113 (= I109), S142 (≠ T138), Y155 (≠ P153), K159 (= K157), P185 (= P183), I188 (= I186), T190 (≠ S188)
1edoA The x-ray structure of beta-keto acyl carrier protein reductase from brassica napus complexed with NADP+ (see paper)
34% identity, 95% coverage: 6:240/248 of query aligns to 4:241/244 of 1edoA
- active site: G12 (= G14), S138 (≠ T138), Y151 (≠ P153), K155 (= K157)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G10), S10 (= S12), R11 (≠ T13), I13 (= I15), N31 (= N33), Y32 (≠ S34), A33 (= A35), R34 (≠ N36), S35 (≠ E37), D59 (= D59), V60 (≠ I60), N86 (= N86), A87 (= A87), S138 (≠ T138), Y151 (≠ P153), K155 (= K157), P181 (= P183), G182 (= G184), I184 (= I186), S186 (= S188), M188 (≠ L190)
5t5qC Crystal structure of short-chain dehydrogenase/reductase sdr:glucose/ribitol dehydrogenase from brucella melitensis
33% identity, 95% coverage: 5:240/248 of query aligns to 9:241/245 of 5t5qC
- active site: G18 (= G14), S140 (≠ T138), N150 (≠ A150), Y153 (≠ P153), K157 (= K157)
- binding nicotinamide-adenine-dinucleotide: N16 (≠ S12), G17 (≠ T13), G18 (= G14), I19 (= I15), D38 (≠ S34), L39 (≠ A35), D63 (= D59), A64 (≠ I60), S90 (≠ N86), I113 (= I109), Y153 (≠ P153), K157 (= K157), P182 (= P183), I185 (= I186), T187 (≠ S188), M189 (≠ L190)
4qecA Elxo with NADP bound (see paper)
31% identity, 96% coverage: 6:243/248 of query aligns to 5:247/248 of 4qecA
- active site: G13 (= G14), N111 (= N110), S139 (≠ T138), Y152 (≠ I154), K156 (= K157)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: K12 (≠ T13), G13 (= G14), I14 (= I15), S33 (= S34), R34 (vs. gap), K38 (≠ N36), D59 (= D59), V60 (≠ I60), N86 (= N86), A87 (= A87), G88 (= G88), I137 (= I136), Y152 (≠ I154), K156 (= K157), P182 (= P183), I185 (= I186)
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
33% identity, 96% coverage: 3:240/248 of query aligns to 4:243/246 of 3osuA
4urfB Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
34% identity, 96% coverage: 5:243/248 of query aligns to 7:247/248 of 4urfB
- active site: G16 (= G14), S142 (≠ T138), I152 (≠ F148), Y155 (≠ A150), K159 (= K157)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: L210 (= L208), R211 (≠ N209), R212 (= R210)
- binding bicarbonate ion: I92 (= I89), G94 (vs. gap), R109 (≠ S105), R179 (= R177), S228 (vs. gap)
- binding nicotinamide-adenine-dinucleotide: G12 (= G10), G14 (≠ S12), N15 (≠ T13), G16 (= G14), I17 (= I15), D36 (≠ S34), I37 (≠ A35), D62 (= D59), T63 (≠ I60), N89 (= N86), A90 (= A87), G91 (= G88), I140 (= I136), Y155 (≠ A150), K159 (= K157), P185 (= P183), A186 (≠ G184), I188 (= I186), T190 (≠ S188)
4urfA Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
34% identity, 96% coverage: 5:243/248 of query aligns to 7:247/248 of 4urfA
- active site: G16 (= G14), S142 (≠ T138), I152 (≠ F148), Y155 (≠ A150), K159 (= K157)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: I92 (= I89), S93 (vs. gap), G94 (vs. gap), E95 (vs. gap), T97 (≠ E91), E101 (= E97), T103 (≠ D99), Q106 (≠ H102), R109 (≠ S105), S175 (≠ K173), G177 (≠ N175)
- binding magnesium ion: S237 (≠ E233), Y238 (≠ I234)
- binding nicotinamide-adenine-dinucleotide: G12 (= G10), G14 (≠ S12), N15 (≠ T13), G16 (= G14), I17 (= I15), D36 (≠ S34), I37 (≠ A35), W41 (≠ L47), D62 (= D59), T63 (≠ I60), N89 (= N86), A90 (= A87), G91 (= G88), I140 (= I136), Y155 (≠ A150), K159 (= K157), P185 (= P183), I188 (= I186), T190 (≠ S188)
4ureB Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
34% identity, 96% coverage: 5:243/248 of query aligns to 7:247/248 of 4ureB
- active site: G16 (= G14), S142 (≠ T138), I152 (≠ F148), Y155 (≠ A150), K159 (= K157)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: N15 (≠ T13), G16 (= G14), I17 (= I15), N89 (= N86), G91 (= G88), Y155 (≠ A150), P185 (= P183), A186 (≠ G184)
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
33% identity, 96% coverage: 3:240/248 of query aligns to 1:236/239 of 3sj7A
- active site: G12 (= G14), S138 (≠ T138), Q148 (≠ A150), Y151 (≠ P153), K155 (= K157)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G10), S10 (= S12), R11 (≠ T13), I13 (= I15), N31 (= N33), Y32 (≠ S34), A33 (= A35), G34 (≠ N36), S35 (≠ E37), A58 (≠ G58), N59 (≠ D59), V60 (≠ I60), N86 (= N86), A87 (= A87), T109 (≠ I109), S138 (≠ T138), Y151 (≠ P153), K155 (= K157), P181 (= P183), G182 (= G184)
3ay6B Crystal structure of bacillus megaterium glucose dehydrogenase 4 a258f mutant in complex with nadh and d-glucose (see paper)
35% identity, 97% coverage: 1:240/248 of query aligns to 11:255/267 of 3ay6B
- active site: G24 (= G14), S151 (≠ T138), Y164 (≠ I154), K168 (= K157)
- binding beta-D-glucopyranose: E102 (≠ F90), S151 (≠ T138), H153 (= H143), W158 (≠ F148), Y164 (≠ I154), N202 (= N194), K205 (≠ S197)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G20 (= G10), T23 (= T13), G24 (= G14), L25 (≠ I15), Y45 (≠ A35), D71 (= D59), V72 (≠ I60), N98 (= N86), A99 (= A87), G100 (= G88), V101 (≠ I89), M149 (≠ I136), S151 (≠ T138), Y164 (≠ I154), K168 (= K157), P194 (= P183), G195 (= G184), M197 (≠ I186), T199 (≠ S188), P200 (= P189), I201 (≠ L190), N202 (= N194)
5t2uA Short chain dehydrogenase/reductase family protein (see paper)
34% identity, 98% coverage: 1:243/248 of query aligns to 4:240/241 of 5t2uA
- active site: G17 (= G14), T135 (≠ V139), T145 (= T151), Y148 (≠ I154), K152 (= K157)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G10), G17 (= G14), R38 (≠ A35), D39 (≠ N36), R42 (≠ N39), D60 (= D59), L61 (≠ I60), N83 (= N86), A84 (= A87), Y87 (≠ F90), I133 (= I136), T135 (≠ V139), Y148 (≠ I154), K152 (= K157), P178 (= P183), P180 (≠ I185), T181 (≠ I186), T183 (≠ S188), T185 (≠ L190), T186 (≠ Q191)
5itvD Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
35% identity, 96% coverage: 5:243/248 of query aligns to 9:226/227 of 5itvD
- active site: G18 (= G14), S141 (≠ T138), Y154 (vs. gap), K158 (= K157)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G10), S17 (≠ T13), G18 (= G14), I19 (= I15), D38 (≠ S34), I39 (≠ A35), T61 (≠ G58), D62 (= D59), I63 (= I60), N89 (= N86), T139 (≠ I136), S141 (≠ T138), Y154 (vs. gap), K158 (= K157), P184 (= P183), G185 (= G184), I187 (= I186)
3o03A Quaternary complex structure of gluconate 5-dehydrogenase from streptococcus suis type 2 (see paper)
34% identity, 98% coverage: 1:243/248 of query aligns to 9:248/254 of 3o03A
- active site: G22 (= G14), S147 (≠ T138), V157 (≠ A150), Y160 (≠ P153), K164 (= K157)
- binding calcium ion: S147 (≠ T138), M148 (≠ V139), P190 (= P183)
- binding D-gluconic acid: I99 (≠ F90), R101 (≠ P92), S147 (≠ T138), M149 (≠ L140), R154 (≠ G147), Y160 (≠ P153)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G10), Y21 (≠ T13), G22 (= G14), I23 (= I15), D42 (≠ S34), I43 (≠ A35), L47 (≠ N39), D68 (= D59), V69 (≠ I60), N95 (= N86), A96 (= A87), G97 (= G88), I145 (= I136), Y160 (≠ P153), K164 (= K157), P190 (= P183)
Query Sequence
>CA265_RS13715 CA265_RS13715 glucose dehydrogenase
MKTLTIIITGASTGIGRAIAALFLKQGHNVVINSANESNLIRAFNELGAQHQLAMVAGDI
SKATTGQLLVETAVARFGTVDVLVNNAGIFEPKAFLEVDEAHLDSFLNINLKGTFFTSQA
AIAQMLKQDGGSIINIGTVLVDHAIGGFPATAPISSKGGIHALTKQLAAEFGKNNIRVNG
IAPGIIRSPLQEKNGISNADDLAGLHLLNRIGETQDVAQLALYLAESNFVTGEIINLDGG
HVAGHHMG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory