SitesBLAST
Comparing CA265_RS13740 FitnessBrowser__Pedo557:CA265_RS13740 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5z5cB Crystal structure of hydrogen sulfide-producing enzyme (fn1055) from fusobacterium nucleatum: lysine-dimethylated form (see paper)
60% identity, 93% coverage: 14:336/348 of query aligns to 4:325/336 of 5z5cB
- active site: K47 (= K57), S273 (= S284)
- binding pyridoxal-5'-phosphate: K47 (= K57), N77 (= N87), G185 (= G195), T186 (= T196), G187 (= G197), T189 (= T199), G230 (= G240), S273 (= S284), P299 (≠ S310), D300 (= D311)
5b55A Crystal structure of hydrogen sulfide-producing enzyme (fn1055) d232n mutant in complexed with alpha-aminoacrylate intermediate: lysine- dimethylated form (see paper)
59% identity, 93% coverage: 14:336/348 of query aligns to 1:322/334 of 5b55A
- active site: K44 (= K57), S270 (= S284)
- binding 2-{[(E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid: K44 (= K57), T71 (= T84), S72 (= S85), N74 (= N87), T75 (= T88), Q145 (= Q158), G180 (= G193), V181 (= V194), G182 (= G195), T183 (= T196), G184 (= G197), T186 (= T199), G227 (= G240), I228 (= I241), S270 (= S284), P296 (≠ S310), D297 (= D311)
- binding pyridoxal-5'-phosphate: K44 (= K57), N74 (= N87), G182 (= G195), T183 (= T196), G184 (= G197), T186 (= T199), S270 (= S284)
P47998 Cysteine synthase 1; At.OAS.5-8; Beta-substituted Ala synthase 1;1; ARAth-Bsas1;1; CSase A; AtCS-A; Cys-3A; O-acetylserine (thiol)-lyase 1; OAS-TL A; O-acetylserine sulfhydrylase; Protein ONSET OF LEAF DEATH 3; EC 2.5.1.47 from Arabidopsis thaliana (Mouse-ear cress) (see 3 papers)
42% identity, 86% coverage: 23:322/348 of query aligns to 12:308/322 of P47998
- K46 (= K57) modified: N6-(pyridoxal phosphate)lysine; mutation to A: No cysteine synthase activity.
- T74 (= T84) mutation to A: Strong reduction of cysteine synthase activity.; mutation to S: Reduction of cysteine synthase activity.
- S75 (= S85) mutation S->A,N,T: Strong reduction of cysteine synthase activity.
- N77 (= N87) binding ; mutation to A: Reduction of cysteine synthase activity.; mutation to D: Strong reduction of cysteine synthase activity.
- T78 (= T88) mutation T->A,S: Reduction of cysteine synthase activity.
- Q147 (= Q158) mutation Q->A,E: Strong reduction of cysteine synthase activity.
- H157 (= H168) mutation H->Q,N: Slight reduction of cysteine synthase activity.
- G162 (= G173) mutation to E: In old3-1; displays a early leaf death phenotype. Abolishes cysteine synthase activity.
- GTGGT 181:185 (= GTGGT 195:199) binding
- T182 (= T196) mutation T->A,S: Slight reduction of cysteine synthase activity.
- T185 (= T199) mutation T->A,S: Strong reduction of cysteine synthase activity.
- K217 (= K232) mutation to A: Impaired interaction with SAT1.
- H221 (= H236) mutation to A: Impaired interaction with SAT1.
- K222 (≠ R237) mutation to A: Impaired interaction with SAT1.
- S269 (= S284) binding ; mutation to A: Strong reduction of cysteine synthase activity.; mutation to T: Reduction of cysteine synthase activity.
2isqA Crystal structure of o-acetylserine sulfhydrylase from arabidopsis thaliana in complex with c-terminal peptide from arabidopsis serine acetyltransferase (see paper)
42% identity, 86% coverage: 23:322/348 of query aligns to 10:306/320 of 2isqA
- active site: K44 (= K57), S267 (= S284)
- binding pyridoxal-5'-phosphate: K44 (= K57), N75 (= N87), G177 (= G193), G179 (= G195), T180 (= T196), G181 (= G197), T183 (= T199), G223 (= G240), S267 (= S284), P294 (≠ S310)
- binding : T72 (= T84), S73 (= S85), G74 (= G86), T76 (= T88), G122 (= G134), M123 (≠ F136), K124 (≠ I137), G217 (= G234), P218 (≠ S235), H219 (= H236), Q222 (= Q239), G223 (= G240)
2q3dA 2.2 a resolution crystal structure of o-acetylserine sulfhydrylase (oass) from mycobacterium tuberculosis in complex with the reaction intermediate alpha-aminoacrylate (see paper)
39% identity, 88% coverage: 18:322/348 of query aligns to 5:305/306 of 2q3dA
- active site: K44 (= K57), S266 (= S284), P293 (≠ S310)
- binding 2-[(3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl)-amino]-propionic acid: K44 (= K57), T71 (= T84), S72 (= S85), N74 (= N87), T75 (= T88), Q144 (= Q158), V177 (= V194), G178 (= G195), T179 (= T196), G180 (= G197), T182 (= T199), G222 (= G240), I223 (= I241), S266 (= S284), P293 (≠ S310), D294 (= D311)
P9WP55 O-acetylserine sulfhydrylase; OAS sulfhydrylase; OASS; Cysteine synthase A; CSase A; O-acetylserine (thiol)-lyase A; OAS-TL A; O-acetylserine-specific cysteine synthase; Sulfide-dependent cysteine synthase; EC 2.5.1.47 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
39% identity, 88% coverage: 18:322/348 of query aligns to 5:305/310 of P9WP55
- K44 (= K57) modified: N6-(pyridoxal phosphate)lysine
- N74 (= N87) binding
- GTGGT 178:182 (= GTGGT 195:199) binding
- S266 (= S284) binding
1z7yA Crystal structure of the arabidopsis thaliana o-acetylserine sulfhydrylase k46a mutant (see paper)
42% identity, 86% coverage: 23:322/348 of query aligns to 10:306/320 of 1z7yA
- active site: A44 (≠ K57), S267 (= S284)
- binding n-[(3-hydroxy-2-methyl-5-{[(trihydroxyphosphoranyl)oxy]methyl}pyridin-4-yl)methylene]methionine: G74 (= G86), N75 (= N87), T76 (= T88), Q145 (= Q158), I178 (≠ V194), G179 (= G195), T180 (= T196), G181 (= G197), T183 (= T199), G223 (= G240), S267 (= S284), P294 (≠ S310), S295 (≠ D311)
8b9wA Cysteine synthase from trypanosoma theileri with plp bound (see paper)
42% identity, 86% coverage: 23:321/348 of query aligns to 16:310/329 of 8b9wA
3zeiA Structure of the mycobacterium tuberculosis o-acetylserine sulfhydrylase (oass) cysk1 in complex with a small molecule inhibitor (see paper)
39% identity, 86% coverage: 18:317/348 of query aligns to 5:300/300 of 3zeiA
- active site: K44 (= K57), S266 (= S284), P293 (≠ S310)
- binding 3-[(Z)-[(5Z)-5-[[2-(2-hydroxy-2-oxoethyloxy)phenyl]methylidene]-3-methyl-4-oxidanylidene-1,3-thiazolidin-2-ylidene]amino]benzoic acid: T71 (= T84), S72 (= S85), I126 (= I140), Q144 (= Q158), F145 (= F159), K215 (= K232), G222 (= G240), A225 (≠ D243), F227 (= F245)
- binding pyridoxal-5'-phosphate: K44 (= K57), N74 (= N87), V177 (= V194), G178 (= G195), T179 (= T196), G180 (= G197), T182 (= T199), G222 (= G240), S266 (= S284), P293 (≠ S310), D294 (= D311)
2q3cA 2.1 a resolution crystal structure of o-acetylserine sulfhydrylase (oass) holoenzyme from mycobacterium tuberculosis in complex with the inhibitory peptide dfsi (see paper)
39% identity, 86% coverage: 18:317/348 of query aligns to 5:300/300 of 2q3cA
- active site: K44 (= K57), S266 (= S284), P293 (≠ S310)
- binding : T71 (= T84), S72 (= S85), G73 (= G86), T75 (= T88), M122 (≠ F136), Q144 (= Q158), K215 (= K232), G222 (= G240), A225 (≠ D243)
7n2tA O-acetylserine sulfhydrylase from citrullus vulgaris in the internal aldimine state, with citrate bound (see paper)
41% identity, 86% coverage: 23:323/348 of query aligns to 10:307/309 of 7n2tA
5xoqA Crystal structure of o-acetylserine sulfhydrylase with bound transcription factor peptide inhibitor from planctomyces limnophilus
41% identity, 88% coverage: 17:323/348 of query aligns to 5:307/310 of 5xoqA
- binding : T72 (= T84), S73 (= S85), G74 (= G86), T76 (= T88), M123 (≠ F136), Q144 (= Q158), R218 (≠ S235), H219 (= H236), Q222 (= Q239), G223 (= G240), A226 (≠ D243)
6ahiB Crystal structure of o-acetylserine dependent cystathionine beta- synthase from helicobacter pylori. (see paper)
38% identity, 85% coverage: 24:318/348 of query aligns to 11:301/306 of 6ahiB
2efyA Crystal structure of t.Th. Hb8 o-acetylserine sulfhydrylase complexed with 4-acetylbutyric acid
40% identity, 86% coverage: 24:321/348 of query aligns to 7:300/302 of 2efyA
- active site: K40 (= K57), S70 (= S85), E200 (= E220), S204 (= S224), S263 (= S284)
- binding 5-oxohexanoic acid: T69 (= T84), G71 (= G86), T73 (= T88), Q141 (= Q158), G175 (= G195), G219 (= G240), M220 (≠ I241), P222 (≠ D243)
- binding pyridoxal-5'-phosphate: K40 (= K57), N72 (= N87), Y172 (≠ A192), G175 (= G195), T176 (= T196), G177 (= G197), T179 (= T199), G219 (= G240), S263 (= S284), P289 (≠ S310), D290 (= D311)
2ecqA Crystal structure of t.Th. Hb8 o-acetylserine sulfhydrylase complexed with 3-hydroxylactate
40% identity, 86% coverage: 24:321/348 of query aligns to 7:300/302 of 2ecqA
- active site: K40 (= K57), S70 (= S85), E200 (= E220), S204 (= S224), S263 (= S284)
- binding (3s)-3-hydroxybutanoic acid: K40 (= K57), G71 (= G86), T73 (= T88), Q141 (= Q158), G219 (= G240)
- binding pyridoxal-5'-phosphate: K40 (= K57), N72 (= N87), Y172 (≠ A192), G173 (= G193), G175 (= G195), T176 (= T196), T179 (= T199), G219 (= G240), S263 (= S284), P289 (≠ S310)
2ecoA Crystal structure of t.Th. Hb8 o-acetylserine sulfhydrylase complexed with 4-methylvalerate
40% identity, 86% coverage: 24:321/348 of query aligns to 7:300/302 of 2ecoA
- active site: K40 (= K57), S70 (= S85), E200 (= E220), S204 (= S224), S263 (= S284)
- binding 4-methyl valeric acid: K40 (= K57), T69 (= T84), G71 (= G86), T73 (= T88), Q141 (= Q158), G175 (= G195), T176 (= T196), G219 (= G240)
- binding pyridoxal-5'-phosphate: K40 (= K57), N72 (= N87), Y172 (≠ A192), G175 (= G195), T176 (= T196), T179 (= T199), G219 (= G240), S263 (= S284), P289 (≠ S310), D290 (= D311)
Q9FS29 Bifunctional L-3-cyanoalanine synthase/cysteine synthase 2, mitochondrial; EC 2.5.1.47; EC 4.4.1.9 from Solanum tuberosum (Potato) (see paper)
41% identity, 87% coverage: 19:321/348 of query aligns to 31:330/347 of Q9FS29
- E157 (≠ K145) mutation E->N,Q: No effect on catalytic activities.
3t4pA Crystal structure of o-acetyl serine sulfhydrylase from leishmania donovani in complex with designed tetrapeptide (see paper)
40% identity, 88% coverage: 18:323/348 of query aligns to 12:313/319 of 3t4pA
- active site: K50 (= K57), S273 (= S284)
- binding : S78 (≠ T84), S79 (= S85), G80 (= G86), T82 (= T88), M129 (≠ F136), Q151 (= Q158), F152 (= F159), G223 (= G234), P224 (≠ S235), H225 (= H236), G229 (= G240), G231 (≠ S242), P232 (≠ D243)
8b9yC Cysteine synthase from trypanosoma cruzi with plp and oas (see paper)
41% identity, 91% coverage: 6:321/348 of query aligns to 7:311/330 of 8b9yC
6kr5B Crystal structure of o-acetyl serine sulfhydrylase isoform 3 from entamoeba histolytica (see paper)
39% identity, 86% coverage: 24:323/348 of query aligns to 19:318/336 of 6kr5B
- binding pyridoxal-5'-phosphate: K56 (= K57), N86 (= N87), V189 (= V194), G190 (= G195), T191 (= T196), A192 (≠ G197), T194 (= T199), G234 (= G240), S278 (= S284), P305 (≠ S310), D306 (= D311)
Query Sequence
>CA265_RS13740 FitnessBrowser__Pedo557:CA265_RS13740
MTTLTRNKMTSAMEGKFEHLSLLVGNTPMLELTYTYQGSLGKIYVKCEHYNLTGSIKDRM
ALYTLKKAYAEGKIKAGDRIVEATSGNTGIAFAAIGKALGHPVTIIMPNWLSKERMDIIK
SLGAEIILVSKEEGGFIGSIKLAEKMAASDPNIFLPKQFENIANPEAHEHTTGKEIWEQL
RLKNLSPDAFVAGVGTGGTIMGVGNFLRKQNADIKIHPLEPAESPTLTTGYKVGSHRIQG
ISDEFIPEIVKLNELDEVLQVNDGDAILMAQKLAEKLGLAVGISSGANVIGAIKQQQKMG
ADSCVVTIFSDSNKKYLSTDLMKVEPVKAGYLTPEVDFIDYQAFSRLH
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory