SitesBLAST
Comparing CA265_RS14455 FitnessBrowser__Pedo557:CA265_RS14455 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2jjgA Crystal structure of the m. Tuberculosis lysine-epsilon aminotransferase (rv3290c) complexed to an inhibitor (see paper)
47% identity, 99% coverage: 5:443/443 of query aligns to 1:434/435 of 2jjgA
- active site: V6 (= V11), F153 (= F158), E224 (= E232), D257 (= D265), Q260 (= Q268), K286 (= K296), T316 (= T326), R408 (= R417)
- binding (2S)-1-methyl-2-[(2S,4R)-2-methyl-4-phenylpentyl]piperidine: A115 (≠ G120), F153 (= F158), G155 (= G160), R156 (= R161), K167 (≠ L172), I170 (≠ K175)
- binding pyridoxal-5'-phosphate: G114 (= G119), A115 (≠ G120), F153 (= F158), H154 (= H159), E224 (= E232), D257 (= D265), V259 (= V267), Q260 (= Q268), K286 (= K296)
2cjhA Lysine aminotransferase from m. Tuberculosis in the internal aldimine form with bound substrate 2-ketoglutarate (see paper)
47% identity, 99% coverage: 5:443/443 of query aligns to 1:434/435 of 2cjhA
- active site: V6 (= V11), F153 (= F158), E224 (= E232), D257 (= D265), Q260 (= Q268), K286 (= K296), T316 (= T326), R408 (= R417)
- binding 2-oxoglutaric acid: V49 (≠ F54), F153 (= F158), R156 (= R161), E229 (= E237), R408 (= R417)
- binding pyridoxal-5'-phosphate: G114 (= G119), A115 (≠ G120), F153 (= F158), H154 (= H159), E224 (= E232), D257 (= D265), V259 (= V267), Q260 (= Q268), K286 (= K296)
2cjgA Lysine aminotransferase from m. Tuberculosis in bound pmp form (see paper)
47% identity, 99% coverage: 5:443/443 of query aligns to 1:434/435 of 2cjgA
- active site: V6 (= V11), F153 (= F158), E224 (= E232), D257 (= D265), Q260 (= Q268), K286 (= K296), T316 (= T326), R408 (= R417)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G114 (= G119), A115 (≠ G120), F153 (= F158), H154 (= H159), E224 (= E232), D257 (= D265), V259 (= V267), K286 (= K296)
2cjdA Lysine aminotransferase from m. Tuberculosis in external aldimine form (see paper)
47% identity, 99% coverage: 5:443/443 of query aligns to 1:434/435 of 2cjdA
- active site: V6 (= V11), F153 (= F158), E224 (= E232), D257 (= D265), Q260 (= Q268), K286 (= K296), T316 (= T326), R408 (= R417)
- binding lysine: V49 (≠ F54), F153 (= F158), R156 (= R161), E229 (= E237), K286 (= K296)
- binding pyridoxal-5'-phosphate: G114 (= G119), A115 (≠ G120), F153 (= F158), H154 (= H159), E224 (= E232), D257 (= D265), V259 (= V267), Q260 (= Q268)
2cinA Lysine aminotransferase from m. Tuberculosis in the internal aldimine form (see paper)
47% identity, 99% coverage: 5:443/443 of query aligns to 1:434/435 of 2cinA
- active site: V6 (= V11), F153 (= F158), E224 (= E232), D257 (= D265), Q260 (= Q268), K286 (= K296), T316 (= T326), R408 (= R417)
- binding pyridoxal-5'-phosphate: G114 (= G119), A115 (≠ G120), F153 (= F158), H154 (= H159), E224 (= E232), D257 (= D265), V259 (= V267), Q260 (= Q268), K286 (= K296)
P80404 4-aminobutyrate aminotransferase, mitochondrial; (S)-3-amino-2-methylpropionate transaminase; GABA aminotransferase; GABA-AT; Gamma-amino-N-butyrate transaminase; GABA transaminase; GABA-T; L-AIBAT; EC 2.6.1.19; EC 2.6.1.22 from Homo sapiens (Human) (see 3 papers)
31% identity, 99% coverage: 1:440/443 of query aligns to 45:496/500 of P80404
- Q56 (≠ N12) to R: in dbSNP:rs1731017
- R220 (= R161) to K: in GABATD; 25% reduction in 4-aminobutyrate aminotransferase activity; dbSNP:rs121434578
- C321 (≠ A260) mutation C->M,S,A,G,K: Loss of 4-aminobutyrate aminotransferase activity.
P80147 4-aminobutyrate aminotransferase, mitochondrial; (S)-3-amino-2-methylpropionate transaminase; GABA aminotransferase; GABA-AT; Gamma-amino-N-butyrate transaminase; GABA transaminase; GABA-T; L-AIBAT; EC 2.6.1.19; EC 2.6.1.22 from Sus scrofa (Pig) (see 3 papers)
31% identity, 99% coverage: 1:440/443 of query aligns to 45:496/500 of P80147
- C163 (≠ G118) binding
- GS 164:165 (≠ GG 119:120) binding in other chain
- C166 (≠ L121) binding
- R220 (= R161) binding
- K357 (= K296) modified: N6-(pyridoxal phosphate)lysine
- T381 (= T326) binding
Sites not aligning to the query:
- 1:28 modified: transit peptide, Mitochondrion
1ohyA 4-aminobutyrate-aminotransferase inactivated by gamma-ethynyl gaba (see paper)
31% identity, 99% coverage: 1:440/443 of query aligns to 7:458/461 of 1ohyA
- active site: F179 (= F158), E255 (= E232), D288 (= D265), Q291 (= Q268), K319 (= K296), T343 (= T326), R435 (= R417)
- binding fe2/s2 (inorganic) cluster: A124 (= A117), C125 (≠ G118), C128 (≠ L121)
- binding (4e)-4-aminohex-4-enoic acid: I62 (≠ F54), F179 (= F158), R182 (= R161), K319 (= K296), F341 (≠ N324), T343 (= T326)
- binding pyridoxal-5'-phosphate: G126 (= G119), S127 (≠ G120), N130 (≠ V123), F179 (= F158), H180 (= H159), G181 (= G160), D288 (= D265), V290 (= V267), Q291 (= Q268), K319 (= K296)
1ohwA 4-aminobutyrate-aminotransferase inactivated by gamma-vinyl gaba (see paper)
31% identity, 99% coverage: 1:440/443 of query aligns to 7:458/461 of 1ohwA
- active site: F179 (= F158), E255 (= E232), D288 (= D265), Q291 (= Q268), K319 (= K296), T343 (= T326), R435 (= R417)
- binding fe2/s2 (inorganic) cluster: C125 (≠ G118), C128 (≠ L121)
- binding pyridoxal-5'-phosphate: G126 (= G119), S127 (≠ G120), F179 (= F158), H180 (= H159), E255 (= E232), D288 (= D265), V290 (= V267)
- binding 4-amino hexanoic acid: I62 (≠ F54), F179 (= F158), R182 (= R161), E260 (= E237), Q291 (= Q268), K319 (= K296), F341 (≠ N324), T343 (= T326)
6b6gA Crystal structure of gaba aminotransferase bound to (s)-3-amino-4- (difluoromethylenyl)cyclopent-1-ene-1-carboxylic acid, an potent inactivatorfor the treatment of addiction (see paper)
31% identity, 99% coverage: 1:440/443 of query aligns to 7:458/461 of 6b6gA
- binding fe2/s2 (inorganic) cluster: C125 (≠ G118), C128 (≠ L121)
- binding (3R,4E)-4-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)imino]cyclopent-1-ene-1,3-dicarboxylic acid: I62 (≠ F54), C125 (≠ G118), G126 (= G119), S127 (≠ G120), F179 (= F158), H180 (= H159), R182 (= R161), E255 (= E232), E260 (= E237), D288 (= D265), V290 (= V267), Q291 (= Q268), K319 (= K296), R435 (= R417)
4y0iA Gaba-aminotransferase inactivated by conformationally-restricted inactivator
31% identity, 99% coverage: 1:440/443 of query aligns to 7:458/461 of 4y0iA
- active site: F179 (= F158), E255 (= E232), D288 (= D265), Q291 (= Q268), K319 (= K296), T343 (= T326), R435 (= R417)
- binding fe2/s2 (inorganic) cluster: C125 (≠ G118), C128 (≠ L121)
- binding 4-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]thiophene-2-carboxylic acid: C125 (≠ G118), G126 (= G119), S127 (≠ G120), F179 (= F158), H180 (= H159), R182 (= R161), E260 (= E237), D288 (= D265), V290 (= V267), Q291 (= Q268), K319 (= K296), F341 (≠ N324), N342 (≠ S325), T343 (= T326)
4y0hD Gamma-aminobutyric acid aminotransferase inactivated by (1s,3s)-3- amino-4-difluoromethylenyl-1-cyclopentanoic acid (cpp-115) (see paper)
31% identity, 99% coverage: 1:440/443 of query aligns to 8:459/463 of 4y0hD
- active site: F180 (= F158), E256 (= E232), D289 (= D265), Q292 (= Q268), K320 (= K296), T344 (= T326), R436 (= R417)
- binding fe2/s2 (inorganic) cluster: C126 (≠ G118), C129 (≠ L121)
- binding pyridoxal-5'-phosphate: C126 (≠ G118), G127 (= G119), S128 (≠ G120), F180 (= F158), H181 (= H159), E256 (= E232), D289 (= D265), V291 (= V267), Q292 (= Q268), K320 (= K296)
4y0dA Gamma-aminobutyric acid aminotransferase inactivated by (1s,3s)-3- amino-4-difluoromethylenyl-1-cyclopentanoic acid (cpp-115) (see paper)
31% identity, 99% coverage: 1:440/443 of query aligns to 8:459/462 of 4y0dA
- active site: F180 (= F158), E256 (= E232), D289 (= D265), Q292 (= Q268), K320 (= K296), T344 (= T326), R436 (= R417)
- binding fe2/s2 (inorganic) cluster: C126 (≠ G118), C129 (≠ L121)
- binding (1S)-4-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]cyclopent-3-ene-1,3-dicarboxylic acid: I63 (≠ F54), C126 (≠ G118), G127 (= G119), S128 (≠ G120), F180 (= F158), H181 (= H159), R183 (= R161), E261 (= E237), D289 (= D265), V291 (= V267), Q292 (= Q268), K320 (= K296), F342 (≠ N324), T344 (= T326), R436 (= R417)
3nx3A Crystal structure of acetylornithine aminotransferase (argd) from campylobacter jejuni
29% identity, 92% coverage: 24:431/443 of query aligns to 11:376/388 of 3nx3A
- active site: F127 (= F158), E179 (= E232), D212 (= D265), Q215 (= Q268), K241 (= K296), T271 (= T326), R362 (= R417)
- binding magnesium ion: N191 (≠ R244), F194 (= F247), I313 (≠ S368), F316 (= F371), D317 (= D372), C319 (≠ M374), Q370 (≠ E425), K371 (≠ Q426)
O66442 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Aquifex aeolicus (strain VF5)
31% identity, 92% coverage: 32:440/443 of query aligns to 17:376/376 of O66442
- GT 96:97 (≠ GG 119:120) binding
- K242 (= K296) modified: N6-(pyridoxal phosphate)lysine
- T271 (= T326) binding
2eh6A Crystal structure of acetylornithine aminotransferase from aquifex aeolicus vf5
31% identity, 92% coverage: 32:440/443 of query aligns to 16:375/375 of 2eh6A
- active site: F127 (= F158), E179 (= E232), D212 (= D265), Q215 (= Q268), K241 (= K296), T270 (= T326), R352 (= R417)
- binding pyridoxal-5'-phosphate: G95 (= G119), T96 (≠ G120), F127 (= F158), H128 (= H159), E179 (= E232), D212 (= D265), V214 (= V267), K241 (= K296)
2ordA Crystal structure of acetylornithine aminotransferase (ec 2.6.1.11) (acoat) (tm1785) from thermotoga maritima at 1.40 a resolution
28% identity, 92% coverage: 35:440/443 of query aligns to 27:390/393 of 2ordA
- active site: F134 (= F158), E186 (= E232), D219 (= D265), Q222 (= Q268), K248 (= K296), T276 (= T326), R367 (= R417)
- binding pyridoxal-5'-phosphate: G102 (= G119), T103 (≠ G120), F134 (= F158), H135 (= H159), E186 (= E232), D219 (= D265), V221 (= V267), Q222 (= Q268), K248 (= K296)
Q9X2A5 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
28% identity, 92% coverage: 35:440/443 of query aligns to 19:382/385 of Q9X2A5
7vo1A Structure of aminotransferase-substrate complex (see paper)
28% identity, 93% coverage: 30:443/443 of query aligns to 38:443/452 of 7vo1A
- binding N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)-L-glutamic acid: I61 (≠ F54), S121 (≠ G118), G122 (= G119), T123 (≠ G120), F149 (= F158), H150 (= H159), R152 (= R161), E234 (= E237), D262 (= D265), V264 (= V267), Q265 (= Q268), K291 (= K296), N318 (≠ S325), T319 (= T326), R417 (= R417)
7vntA Structure of aminotransferase-substrate complex (see paper)
28% identity, 93% coverage: 30:443/443 of query aligns to 38:443/452 of 7vntA
- binding L-ornithine: F149 (= F158), R152 (= R161), E234 (= E237), K291 (= K296)
- binding pyridoxal-5'-phosphate: G122 (= G119), T123 (≠ G120), F149 (= F158), H150 (= H159), E229 (= E232), D262 (= D265), V264 (= V267), Q265 (= Q268), K291 (= K296)
Query Sequence
>CA265_RS14455 FitnessBrowser__Pedo557:CA265_RS14455
MYQLTVPADRVNESLSKHILADGFDLTYDMEKSHGAYIYDAKHNRTLLDFFTCFASVPLG
YNHPKMINDEAFKKNLFLAALANPSNSDVYTQQYAQFVETFSKVGIPDYLPHAFFIAGGG
LAVENAIKVAMDWKVQKNFAKGYTEEKGFKVLHFERAFHGRTGYTLSLTNTLPDKTKWFA
KFDWPRVAVPEVKFPLSGNNLSHAIQTEETSLAQIKKAIADNKDDICAIIVEPIQSEGGD
NHLREEFLIQIKALADENDAFLIYDEVQTGVGLTGKFWCHQHFSEKARPDILAFGKKMQV
CGILVGHKVDQVETNVFKVPSRINSTWGGNLVDMVRSTQILQIVEEDQLCENATKVGLYL
KDQLENLSHRFDQMTNVRGRGLLCSFDFPTKEMRNTFIAKGLENNVMFLGCGEKTIRFRP
ALCIEQKHIDEGLTVMDKILPLL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory