SitesBLAST
Comparing CA265_RS14465 FitnessBrowser__Pedo557:CA265_RS14465 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q96329 Acyl-coenzyme A oxidase 4, peroxisomal; AOX 4; G6p; Short-chain acyl-CoA oxidase; AtCX4; AtG6; SAOX; EC 1.3.3.6 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
49% identity, 86% coverage: 63:452/453 of query aligns to 41:428/436 of Q96329
2ix6A Short chain specific acyl-coa oxidase from arabidopsis thaliana, acx4 (see paper)
49% identity, 86% coverage: 63:452/453 of query aligns to 25:412/416 of 2ix6A
- active site: L158 (= L197), T159 (= T198), S271 (≠ T311), E392 (= E432), R404 (= R444)
- binding flavin-adenine dinucleotide: T159 (= T198), G164 (= G203), S165 (= S204), W189 (= W229), N239 (= N279), R297 (= R337), F300 (= F340), L304 (≠ I344), F307 (= F347), N310 (≠ I350), E365 (= E405), L366 (≠ V406), G369 (= G409), I372 (= I412), Y391 (= Y431), T394 (= T434), D396 (≠ E436)
2ix5A Short chain specific acyl-coa oxidase from arabidopsis thaliana, acx4 in complex with acetoacetyl-coa (see paper)
49% identity, 86% coverage: 63:452/453 of query aligns to 25:412/415 of 2ix5A
- active site: L158 (= L197), T159 (= T198), S271 (≠ T311), E392 (= E432), R404 (= R444)
- binding acetoacetyl-coenzyme a: S165 (= S204), A167 (= A206), S168 (≠ A207), F261 (= F301), L268 (= L308), R272 (= R312), E392 (= E432), G393 (= G433), R404 (= R444)
- binding flavin-adenine dinucleotide: L158 (= L197), T159 (= T198), G164 (= G203), S165 (= S204), W189 (= W229), N239 (= N279), R297 (= R337), F300 (= F340), L304 (≠ I344), F307 (= F347), L309 (= L349), N310 (≠ I350), E365 (= E405), L366 (≠ V406), G368 (= G408), G369 (= G409), Y391 (= Y431), T394 (= T434), D396 (≠ E436), I397 (= I437)
2ebaA Crystal structure of the putative glutaryl-coa dehydrogenase from thermus thermophilus
40% identity, 85% coverage: 69:452/453 of query aligns to 3:380/380 of 2ebaA
- active site: L131 (= L197), T132 (= T198), A239 (≠ T311), E360 (= E432), R372 (= R444)
- binding flavin-adenine dinucleotide: L131 (= L197), T132 (= T198), G136 (≠ V202), G137 (= G203), S138 (= S204), W161 (= W229), T163 (≠ G231), R265 (= R337), L272 (≠ I344), K275 (≠ F347), D333 (≠ E405), I334 (≠ V406), G337 (= G409), T355 (≠ A427), T358 (≠ S430), Y359 (= Y431), T362 (= T434)
3sf6A Crystal structure of glutaryl-coa dehydrogenase from mycobacterium smegmatis (see paper)
38% identity, 83% coverage: 78:452/453 of query aligns to 14:386/387 of 3sf6A
- active site: L134 (= L197), T135 (= T198), A245 (≠ T311), E366 (= E432), Q378 (≠ R444)
- binding dihydroflavine-adenine dinucleotide: F132 (= F195), L134 (= L197), T135 (= T198), G140 (= G203), S141 (= S204), W165 (= W229), I166 (= I230), T167 (≠ G231), S361 (≠ A427), T364 (≠ S430), Y365 (= Y431), T368 (= T434), E370 (= E436), M371 (≠ I437)
2r0nA The effect of a glu370asp mutation in glutaryl-coa dehydrogenase on proton transfer to the dienolate intermediate (see paper)
37% identity, 84% coverage: 75:453/453 of query aligns to 11:389/390 of 2r0nA
- active site: L133 (= L197), T134 (= T198), A247 (≠ T311), E368 (= E432), R380 (= R444)
- binding flavin-adenine dinucleotide: F131 (= F195), L133 (= L197), T134 (= T198), G139 (= G203), S140 (= S204), W166 (= W229), I167 (= I230), T168 (≠ G231), Y367 (= Y431), T370 (= T434), D372 (≠ E436)
- binding 3-thiaglutaryl-CoA: R92 (≠ S156), S93 (≠ T157), V97 (= V161), P142 (≠ A206), G238 (≠ K302), F241 (≠ A305), L244 (= L308), N245 (≠ Q309), P318 (≠ D382), Y367 (= Y431), E368 (= E432), I377 (= I441)
1sirA The crystal structure and mechanism of human glutaryl-coa dehydrogenase (see paper)
37% identity, 84% coverage: 75:453/453 of query aligns to 11:389/390 of 1sirA
- active site: L133 (= L197), T134 (= T198), A247 (≠ T311), E368 (= E432), R380 (= R444)
- binding flavin-adenine dinucleotide: F131 (= F195), L133 (= L197), T134 (= T198), G139 (= G203), S140 (= S204), W166 (= W229), I167 (= I230), T168 (≠ G231), Y367 (= Y431), T370 (= T434)
- binding s-4-nitrobutyryl-coa: S93 (≠ T157), S140 (= S204), F241 (≠ A305), G242 (≠ K306), L244 (= L308), N245 (≠ Q309), R248 (= R312), P318 (≠ D382), Y367 (= Y431), E368 (= E432), R380 (= R444)
2r0mA The effect of a glu370asp mutation in glutaryl-coa dehydrogenase on proton transfer to the dienolate intermediate (see paper)
37% identity, 84% coverage: 75:453/453 of query aligns to 11:389/390 of 2r0mA
- active site: L133 (= L197), T134 (= T198), A247 (≠ T311), D368 (≠ E432), R380 (= R444)
- binding 4-nitrobutanoic acid: L101 (= L165), Y367 (= Y431), D368 (≠ E432)
- binding flavin-adenine dinucleotide: F131 (= F195), L133 (= L197), T134 (= T198), G139 (= G203), S140 (= S204), W166 (= W229), I167 (= I230), T168 (≠ G231), L210 (= L274), Y367 (= Y431), T370 (= T434)
3swoA Crystal structure of a glutaryl-coa dehydrogenase from mycobacterium smegmatis in complex with fadh2 (see paper)
34% identity, 83% coverage: 75:452/453 of query aligns to 13:387/388 of 3swoA
- active site: L135 (= L197), T136 (= T198), A246 (≠ T311), E367 (= E432), K379 (≠ R444)
- binding dihydroflavine-adenine dinucleotide: F133 (= F195), L135 (= L197), T136 (= T198), G141 (= G203), S142 (= S204), W166 (= W229), I167 (= I230), T168 (≠ G231), R272 (= R337), V274 (≠ Q339), F275 (= F340), L279 (≠ I344), Y282 (≠ F347), T340 (vs. gap), L341 (≠ V406), G344 (= G409), I347 (= I412), T365 (≠ S430), Y366 (= Y431), T369 (= T434), E371 (= E436), M372 (≠ I437)
3eonC 2.55a crystal structure of native glutaryl-coa dehydrogenase from burkholderia pseudomallei in complex with a small molecule (see paper)
34% identity, 83% coverage: 75:451/453 of query aligns to 12:382/382 of 3eonC
3gqtC Crystal structure of glutaryl-coa dehydrogenase from burkholderia pseudomallei with fragment (1,4-dimethyl-1,2,3,4- tetrahydroquinoxalin-6-yl)methylamine (see paper)
34% identity, 83% coverage: 75:452/453 of query aligns to 12:385/385 of 3gqtC
- active site: L135 (= L197), T136 (= T198), A250 (≠ T311), E365 (= E432), R377 (= R444)
- binding 1-(1,4-dimethyl-1,2,3,4-tetrahydroquinoxalin-6-yl)methanamine: W166 (= W229), K210 (= K271), L213 (= L274), T218 (≠ N279), Y364 (= Y431)
3gncA Crystal structure of glutaryl-coa dehydrogenase from burkholderia pseudomallei with fragment 6421 (see paper)
34% identity, 83% coverage: 75:451/453 of query aligns to 13:380/380 of 3gncA
4n5fA Crystal structure of a putative acyl-coa dehydrogenase with bound fadh2 from burkholderia cenocepacia j2315
35% identity, 82% coverage: 75:444/453 of query aligns to 3:376/378 of 4n5fA
- active site: L126 (= L197), T127 (= T198), G243 (≠ T311), E364 (= E432), R376 (= R444)
- binding dihydroflavine-adenine dinucleotide: L126 (= L197), T127 (= T198), G132 (= G203), S133 (= S204), F157 (≠ W229), T159 (≠ G231), T210 (≠ N279), Y363 (= Y431), T366 (= T434), E368 (= E436), M372 (≠ L440)
3d6bC 2.2 a crystal structure of glutaryl-coa dehydrogenase from burkholderia pseudomallei (see paper)
32% identity, 83% coverage: 75:451/453 of query aligns to 12:377/377 of 3d6bC
5lnxD Crystal structure of mmgc, an acyl-coa dehydrogenase from bacillus subtilis.
35% identity, 79% coverage: 89:448/453 of query aligns to 13:374/374 of 5lnxD
- active site: L122 (= L197), T123 (= T198), G239 (≠ T311), E358 (= E432), K370 (≠ R444)
- binding flavin-adenine dinucleotide: L122 (= L197), T123 (= T198), G128 (= G203), S129 (= S204), F153 (≠ W229), T155 (≠ G231), R265 (= R337), Q267 (= Q339), F268 (= F340), I272 (= I344), N275 (≠ F347), I278 (= I350), Q331 (≠ E405), I332 (≠ V406), G335 (= G409), Y357 (= Y431), T360 (= T434), E362 (= E436)
4l1fA Electron transferring flavoprotein of acidaminococcus fermentans: towards a mechanism of flavin-based electron bifurcation (see paper)
32% identity, 81% coverage: 81:446/453 of query aligns to 7:377/380 of 4l1fA
- active site: L125 (= L197), T126 (= T198), G242 (≠ T311), E363 (= E432), R375 (= R444)
- binding coenzyme a persulfide: T132 (≠ S204), H179 (≠ K252), F232 (= F301), M236 (≠ A305), E237 (≠ K306), L239 (= L308), D240 (≠ Q309), R243 (= R312), Y362 (= Y431), E363 (= E432), G364 (= G433), R375 (= R444)
- binding flavin-adenine dinucleotide: F123 (= F195), L125 (= L197), T126 (= T198), G131 (= G203), T132 (≠ S204), F156 (≠ W229), I157 (= I230), T158 (≠ G231), R268 (= R337), Q270 (= Q339), F271 (= F340), I275 (= I344), F278 (= F347), L281 (≠ I350), Q336 (≠ E405), I337 (≠ V406), G340 (= G409), I358 (≠ A427), Y362 (= Y431), T365 (= T434), Q367 (≠ E436)
- binding 1,3-propandiol: Q10 (≠ E84)
Sites not aligning to the query:
5ol2F The electron transferring flavoprotein/butyryl-coa dehydrogenase complex from clostridium difficile (see paper)
32% identity, 78% coverage: 91:442/453 of query aligns to 17:372/378 of 5ol2F
- active site: L124 (= L197), T125 (= T198), G241 (≠ T311)
- binding calcium ion: E29 (≠ H103), E33 (≠ K107), R35 (≠ E109)
- binding coenzyme a persulfide: L238 (= L308), R242 (= R312), E362 (= E432), G363 (= G433)
- binding flavin-adenine dinucleotide: F122 (= F195), L124 (= L197), T125 (= T198), P127 (= P200), T131 (≠ S204), F155 (≠ W229), I156 (= I230), T157 (≠ G231), E198 (≠ Q269), R267 (= R337), F270 (= F340), L274 (≠ I344), F277 (= F347), Q335 (≠ E405), L336 (≠ V406), G338 (= G408), G339 (= G409), Y361 (= Y431), T364 (= T434), E366 (= E436)
Sites not aligning to the query:
6fahD Molecular basis of the flavin-based electron-bifurcating caffeyl-coa reductase reaction (see paper)
32% identity, 81% coverage: 78:442/453 of query aligns to 3:372/379 of 6fahD
- active site: L124 (= L197), T125 (= T198), G241 (≠ T311)
- binding flavin-adenine dinucleotide: F122 (= F195), L124 (= L197), T125 (= T198), R152 (≠ Q226), F155 (≠ W229), T157 (≠ G231), E198 (≠ Q269), R267 (= R337), Q269 (= Q339), F270 (= F340), I274 (= I344), F277 (= F347), Q335 (≠ E405), I336 (≠ V406), G339 (= G409), Y361 (= Y431), T364 (= T434), Q366 (≠ E436)
Sites not aligning to the query:
4m9aB Crystal structure of acyl-coa dehydrogenase from burkholderia thailandensis e264
33% identity, 82% coverage: 75:446/453 of query aligns to 1:376/376 of 4m9aB
- active site: L124 (= L197), T125 (= T198), G241 (≠ T311), E362 (= E432), R374 (= R444)
- binding dihydroflavine-adenine dinucleotide: F122 (= F195), T125 (= T198), G130 (= G203), S131 (= S204), F155 (≠ W229), T157 (≠ G231), T208 (≠ N279), Y361 (= Y431), T364 (= T434), E366 (= E436), M370 (≠ L440)
1ukwB Crystal structure of medium-chain acyl-coa dehydrogenase from thermus thermophilus hb8
33% identity, 82% coverage: 75:446/453 of query aligns to 2:376/379 of 1ukwB
- active site: L124 (= L197), S125 (≠ T198), T241 (= T311), E362 (= E432), R374 (= R444)
- binding cobalt (ii) ion: D145 (= D218), H146 (≠ K220)
- binding flavin-adenine dinucleotide: F122 (= F195), L124 (= L197), S125 (≠ T198), G130 (= G203), S131 (= S204), W155 (= W229), S157 (≠ G231), K200 (= K271), L357 (≠ A427), Y361 (= Y431), E362 (= E432), T364 (= T434), E366 (= E436), L370 (= L440)
Query Sequence
>CA265_RS14465 FitnessBrowser__Pedo557:CA265_RS14465
MANIFSSLKNAYNLFKHIDFDKLEALSKKVDLPKMVETISNLDDKQIQGMMKMMGGSGKK
KELPPIEGDFYHLGDEALKDEDRELQLKVRAFLEKEVKPIVNHYWNKAEFPFEIIPKLAE
LNICGLTYKGYGCPGKSNLMEGILAMEMARIDTSISTFFGVQSGLAMGSIYLCGSEEQKQ
QWLPLMQQFKIIGAFGLTEPEVGSAAAGGLTTTCKKVDGKWVLNGQKKWIGNATFADILI
IWARDEESGEVKGFIVKKDNPGFAVEKMQDKMALRIVQNGIITLTNCEVEEADRLQNANS
FKDTAKVLQMTRAGVAWQAVGCARGAYENALDYTRTRKQFGKPIASFQLIQNHLVEMLSN
LTAMQTLCFRLSQLQDQGLLKDEHASLAKVFCSLRTRDVVSRAREVMGGNGILLEYNVAR
FVADAEAIYSYEGTKEINTLIVGRAITGFSAFV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory