Comparing CA265_RS15090 FitnessBrowser__Pedo557:CA265_RS15090 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7mh7A Crystal structure of NAD kinase from pseudomonas aeruginosa pao1
31% identity, 97% coverage: 3:287/293 of query aligns to 6:287/290 of 7mh7A
P0A7B3 NAD kinase; ATP-dependent NAD kinase; EC 2.7.1.23 from Escherichia coli (strain K12) (see paper)
33% identity, 78% coverage: 59:286/293 of query aligns to 58:287/292 of P0A7B3
P9WHV7 NAD kinase; ATP-dependent NAD kinase; Poly(P)-dependent NAD kinase; PPNK; EC 2.7.1.23 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 3 papers)
30% identity, 75% coverage: 66:284/293 of query aligns to 77:297/307 of P9WHV7
Sites not aligning to the query:
1y3iA Crystal structure of mycobacterium tuberculosis NAD kinase-NAD complex (see paper)
30% identity, 73% coverage: 72:284/293 of query aligns to 12:226/231 of 1y3iA
3afoA Crystal structure of yeast nadh kinase complexed with nadh
34% identity, 59% coverage: 65:236/293 of query aligns to 111:285/360 of 3afoA
Sites not aligning to the query:
1z0zA Crystal structure of a NAD kinase from archaeoglobus fulgidus in complex with NAD (see paper)
27% identity, 81% coverage: 47:284/293 of query aligns to 22:245/249 of 1z0zA
1z0sA Crystal structure of an NAD kinase from archaeoglobus fulgidus in complex with atp (see paper)
27% identity, 81% coverage: 47:284/293 of query aligns to 22:245/249 of 1z0sA
Sites not aligning to the query:
1suwA Crystal structure of a NAD kinase from archaeoglobus fulgidus in complex with its substrate and product: insights into the catalysis of NAD kinase (see paper)
27% identity, 81% coverage: 47:284/293 of query aligns to 22:245/249 of 1suwA
O30297 NAD kinase; ATP-dependent NAD kinase; EC 2.7.1.23 from Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16) (see paper)
27% identity, 81% coverage: 47:284/293 of query aligns to 22:245/249 of O30297
Q9P7K3 Uncharacterized kinase C24B10.02c; EC 2.7.1.- from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
27% identity, 77% coverage: 66:292/293 of query aligns to 176:412/449 of Q9P7K3
Sites not aligning to the query:
O13863 Uncharacterized kinase C1B1.02c; EC 2.7.1.- from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
27% identity, 78% coverage: 59:286/293 of query aligns to 273:511/537 of O13863
Sites not aligning to the query:
7zzdA Crystal structure of NAD kinase 1 from listeria monocytogenes in complex with a linear di-adenosine derivative (see paper)
29% identity, 68% coverage: 66:265/293 of query aligns to 37:244/262 of 7zzdA
7zz9A Crystal structure of NAD kinase 1 from listeria monocytogenes in complex with a linear di-adenosine derivative (see paper)
29% identity, 68% coverage: 66:265/293 of query aligns to 37:244/262 of 7zz9A
6z64A Crystal structure of NAD kinase 1 from listeria monocytogenes in complex with a di-adenosine derivative (see paper)
29% identity, 68% coverage: 66:265/293 of query aligns to 37:244/262 of 6z64A
5dhuA Crystal structure of NAD kinase 1 from listeria monocytogenes in complex with a novel inhibitor (see paper)
29% identity, 68% coverage: 66:265/293 of query aligns to 37:245/263 of 5dhuA
5dhtA Crystal structure of NAD kinase 1 from listeria monocytogenes in complex with a novel inhibitor (see paper)
29% identity, 68% coverage: 66:265/293 of query aligns to 37:245/263 of 5dhtA
5dhsA Crystal structure of NAD kinase 1 from listeria monocytogenes in complex with a novel inhibitor (see paper)
29% identity, 68% coverage: 66:265/293 of query aligns to 37:245/263 of 5dhsA
5dhrA Crystal structure of NAD kinase 1 from listeria monocytogenes in complex with a novel inhibitor (see paper)
29% identity, 68% coverage: 66:265/293 of query aligns to 37:245/263 of 5dhrA
5dhqA Crystal structure of NAD kinase 1 from listeria monocytogenes in complex with a novel inhibitor (see paper)
29% identity, 68% coverage: 66:265/293 of query aligns to 37:245/263 of 5dhqA
5dhpA Crystal structure of NAD kinase 1 from listeria monocytogenes in complex with a novel inhibitor (see paper)
29% identity, 68% coverage: 66:265/293 of query aligns to 37:245/263 of 5dhpA
>CA265_RS15090 FitnessBrowser__Pedo557:CA265_RS15090
MRIAIYGRDFNDTVLPYVQEVFNHLAEHHIQPVLYSKFKTSLHGKIKLPANTVIFHNHTE
LKELADVLLSLGGDGTLLDTLSLIRNSGIPVIGINFGRLGFLASINKNEIASALKALINK
EYTLDSRSLLTLESDNGLFGEENFALNDITIHRRDNSAMMIIHASMNDEFINSYWADGLI
IATPTGSTAYSLSCGGPIIYPDSENFVITPIAPHNLNVRPVILPDDNKLSFEVEARESKF
LVSCDSRTVTVERSVKISIKKADFCVNLIRLNNETYLNTLRNKLLWGIDTRNY
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory