SitesBLAST
Comparing CA265_RS15110 FitnessBrowser__Pedo557:CA265_RS15110 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3asvA The closed form of serine dehydrogenase complexed with NADP+ (see paper)
46% identity, 97% coverage: 4:248/252 of query aligns to 2:243/248 of 3asvA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G7 (= G9), T9 (= T11), G11 (= G13), F12 (≠ I14), R32 (= R34), R33 (= R35), D54 (= D60), V55 (= V61), N81 (= N87), G83 (= G89), I132 (= I138), S134 (= S140), Y147 (= Y153), K151 (= K157), G178 (= G184), V180 (= V186), T183 (= T188), E184 (= E189), F185 (= F190)
- binding phosphate ion: S134 (= S140), Y147 (= Y153), G178 (= G184), F185 (= F190)
Q9P7B4 NADP-dependent 3-hydroxy acid dehydrogenase; L-allo-threonine dehydrogenase; EC 1.1.1.381 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
42% identity, 99% coverage: 3:251/252 of query aligns to 7:256/259 of Q9P7B4
- S42 (≠ D37) modified: Phosphoserine
- T43 (≠ R38) modified: Phosphothreonine
6ixjA The crystal structure of sulfoacetaldehyde reductase from klebsiella oxytoca (see paper)
47% identity, 96% coverage: 2:244/252 of query aligns to 1:242/251 of 6ixjA
- binding 2-hydroxyethylsulfonic acid: S138 (= S140), Y145 (= Y147), Y151 (= Y153)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G9), T10 (= T11), S11 (= S12), G12 (= G13), F13 (≠ I14), R33 (= R34), R34 (= R35), D57 (= D60), V58 (= V61), N84 (= N87), A85 (= A88), G86 (= G89), T108 (= T111), I136 (= I138), S138 (= S140), Y151 (= Y153), K155 (= K157), P181 (= P183), G182 (= G184), A184 (≠ V186), T186 (= T188), E187 (= E189), F188 (= F190)
Q05016 NADP-dependent 3-hydroxy acid dehydrogenase; L-allo-threonine dehydrogenase; EC 1.1.1.-; EC 1.1.1.381 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
41% identity, 99% coverage: 3:251/252 of query aligns to 14:266/267 of Q05016
- N102 (= N87) binding
- Y168 (= Y153) binding
- K172 (= K157) binding
3rkuA Substrate fingerprint and the structure of NADP+ dependent serine dehydrogenase from saccharomyces cerevisiae complexed with NADP+
41% identity, 99% coverage: 3:251/252 of query aligns to 15:267/268 of 3rkuA
- active site: A107 (≠ S91), N128 (= N112), S156 (= S140), Y169 (= Y153), K173 (= K157), N214 (≠ D198)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G21 (= G9), S23 (≠ T11), G25 (= G13), I26 (= I14), R49 (= R34), R50 (= R35), D76 (= D60), I77 (≠ V61), N103 (= N87), A104 (= A88), G105 (= G89), K106 (≠ L90), S156 (= S140), Y169 (= Y153), K173 (= K157), P199 (= P183), G200 (= G184), V202 (= V186), T204 (= T188), E205 (= E189), F206 (= F190)
1xg5C Structure of human putative dehydrogenase mgc4172 in complex with nadp
34% identity, 95% coverage: 3:242/252 of query aligns to 11:256/257 of 1xg5C
- active site: S150 (= S140), Y165 (= Y153), K169 (= K157)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G17 (= G9), S19 (≠ T11), G21 (= G13), I22 (= I14), A41 (= A33), R42 (= R34), T43 (≠ R35), D69 (= D60), L70 (≠ V61), N96 (= N87), G98 (= G89), I148 (= I138), S150 (= S140), Y165 (= Y153), K169 (= K157), G198 (= G184), V200 (= V186), T202 (= T188), F204 (= F190), K207 (≠ V193)
3p19A Improved NADPH-dependent blue fluorescent protein (see paper)
36% identity, 96% coverage: 1:243/252 of query aligns to 1:237/239 of 3p19A
- active site: S132 (= S140), Y145 (= Y153), K149 (= K157)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G9 (= G9), S11 (≠ T11), S12 (= S12), G13 (= G13), I14 (= I14), A33 (= A33), R34 (= R34), R35 (= R35), D53 (= D60), V54 (= V61), N80 (= N87), A81 (= A88), G82 (= G89), I130 (= I138), S132 (= S140), Y145 (= Y153), K149 (= K157), P175 (= P183), A177 (≠ M185), V178 (= V186), T180 (= T188), E181 (= E189), L182 (≠ F190)
2japA Clavulanic acid dehydrogenase: structural and biochemical analysis of the final step in the biosynthesis of the beta- lactamase inhibitor clavulanic acid (see paper)
36% identity, 96% coverage: 3:243/252 of query aligns to 6:244/245 of 2japA
- active site: S140 (= S140), Y153 (= Y153), K157 (= K157), A198 (≠ R201)
- binding (2r,3z,5r)-3-(2-hydroxyethylidene)-7-oxo-4-oxa-1-azabicyclo[3.2.0]heptane-2-carboxylic acid: M93 (≠ S91), S140 (= S140), A142 (= A142), Y153 (= Y153), T185 (≠ M185), Y203 (= Y206), R206 (vs. gap)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G12 (= G9), S14 (≠ T11), S15 (= S12), G16 (= G13), I17 (= I14), A36 (= A33), R37 (= R34), R38 (= R35), L61 (≠ A59), D62 (= D60), V63 (= V61), N89 (= N87), A90 (= A88), G91 (= G89), T112 (= T111), M138 (≠ I138), S139 (≠ G139), S140 (= S140), Y153 (= Y153), K157 (= K157), P183 (= P183), T185 (≠ M185), T186 (≠ V186), T188 (= T188), E189 (= E189), L190 (≠ F190)
2jahC Biochemical and structural analysis of the clavulanic acid dehydeogenase (cad) from streptomyces clavuligerus (see paper)
36% identity, 96% coverage: 3:243/252 of query aligns to 7:245/246 of 2jahC
- active site: S141 (= S140), Y154 (= Y153), K158 (= K157), A199 (≠ R201)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G13 (= G9), S15 (≠ T11), S16 (= S12), G17 (= G13), I18 (= I14), A37 (= A33), R38 (= R34), R39 (= R35), D63 (= D60), V64 (= V61), N90 (= N87), A91 (= A88), G92 (= G89), T113 (= T111), M139 (≠ I138), S141 (= S140), Y154 (= Y153), K158 (= K157), P184 (= P183), G185 (= G184), T186 (≠ M185), T187 (≠ V186), T189 (= T188), E190 (= E189), L191 (≠ F190)
A0A1U8QWA2 Glycine betaine reductase ATRR; Nonribosomal peptide synthetase-like protein ATRR; EC 1.2.1.-; EC 1.1.1.- from Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans) (see paper)
31% identity, 94% coverage: 3:240/252 of query aligns to 1030:1265/1270 of A0A1U8QWA2
- G1036 (= G9) mutation to A: Compromises binding of the cosubstrate NADPH to aldehyde reductase domain R2. Decreases the aldehyde reductase activity by 4,000-fold; when associated with F-1178.
- Y1178 (= Y153) mutation to F: Does not substantially affect carboxylic acid reductase activity but results to a 150-fold loss of aldehyde reductase activity and the accumulation of glycine betaine aldehyde intermediate. Further decreases the aldehyde reductase activity by 4,000-fold; when associated with F-1178.
Sites not aligning to the query:
- 14:418 Adenylation (A) domain
- 643:937 Carboxylic acid reductase domain R1
- 812 Y→F: Abolishes overall carboxylic acid reductase activity but does nor affect aldehyde reductase activity.
- 1026:1256 Aldehyde reductase domain R2
7w61A Crystal structure of farnesol dehydrogenase from helicoverpa armigera (see paper)
33% identity, 96% coverage: 1:243/252 of query aligns to 7:246/249 of 7w61A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G9), S17 (≠ T11), S18 (= S12), G19 (= G13), I20 (= I14), A39 (= A33), R40 (= R34), R41 (= R35), C63 (≠ A59), D64 (= D60), V65 (= V61), N91 (= N87), A92 (= A88), G93 (= G89), I94 (≠ L90), I119 (≠ T111), I147 (= I138), Y164 (= Y153), K168 (= K157), P196 (= P183), G197 (= G184), L198 (≠ M185), V199 (= V186), T201 (= T188), A202 (≠ E189), M203 (≠ F190)
2ehdB Crystal structure analysis of oxidoreductase
28% identity, 96% coverage: 1:241/252 of query aligns to 3:213/213 of 2ehdB
4qecA Elxo with NADP bound (see paper)
33% identity, 75% coverage: 1:189/252 of query aligns to 1:188/248 of 4qecA
- active site: G13 (= G13), N111 (= N112), S139 (= S140), Y152 (= Y153), K156 (= K157)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: K12 (≠ S12), G13 (= G13), I14 (= I14), S33 (≠ A33), R34 (= R34), K38 (≠ R38), D59 (= D60), V60 (= V61), N86 (= N87), A87 (= A88), G88 (= G89), I137 (= I138), Y152 (= Y153), K156 (= K157), P182 (= P183), I185 (≠ V186)
5u9pB Crystal structure of a gluconate 5-dehydrogenase from burkholderia cenocepacia j2315 in complex with NADP and tartrate
34% identity, 75% coverage: 2:191/252 of query aligns to 16:203/261 of 5u9pB
- active site: G27 (= G13), S152 (= S140), Y165 (= Y153), K169 (= K157)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G23 (= G9), R26 (≠ S12), G27 (= G13), I28 (= I14), R48 (= R34), D73 (= D60), V74 (= V61), N100 (= N87), A101 (= A88), I150 (= I138), Y165 (= Y153), K169 (= K157), P195 (= P183), F198 (≠ V186), T200 (= T188), L202 (≠ F190), N203 (≠ S191)
P0AEK2 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Escherichia coli (strain K12) (see 2 papers)
31% identity, 89% coverage: 2:226/252 of query aligns to 5:224/244 of P0AEK2
- GASR 12:15 (≠ GATS 9:12) binding
- T37 (≠ R34) binding
- NV 59:60 (≠ DV 60:61) binding
- N86 (= N87) binding
- Y151 (= Y153) mutation to F: Defect in the affinity for NADPH.
- YAAAK 151:155 (≠ YCASK 153:157) binding
- A154 (≠ S156) mutation to T: Decreases in the thermolability of the reductase; when associated with K-233.
- K155 (= K157) mutation to A: Defect in the affinity for NADPH.
- I184 (≠ V186) binding
Sites not aligning to the query:
- 233 E→K: Decreases in the thermolability of the reductase; when associated with T-154.
1q7bA The structure of betaketoacyl-[acp] reductase from e. Coli in complex with NADP+ (see paper)
31% identity, 89% coverage: 2:226/252 of query aligns to 4:223/243 of 1q7bA
- active site: G15 (= G13), E101 (≠ D104), S137 (= S140), Q147 (≠ G150), Y150 (= Y153), K154 (= K157)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G9), S13 (≠ T11), R14 (≠ S12), T36 (≠ R34), N58 (≠ D60), V59 (= V61), N85 (= N87), A86 (= A88), G87 (= G89), I88 (≠ L90), S137 (= S140), Y150 (= Y153), K154 (= K157), P180 (= P183), G181 (= G184), I183 (≠ V186)
Sites not aligning to the query:
3op4A Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. N16961 in complex with NADP+ (see paper)
29% identity, 89% coverage: 3:226/252 of query aligns to 9:227/247 of 3op4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G9), S17 (≠ T11), R18 (≠ S12), I20 (= I14), T40 (≠ R34), N62 (≠ D60), V63 (= V61), N89 (= N87), A90 (= A88), I92 (≠ L90), V139 (≠ I138), S141 (= S140), Y154 (= Y153), K158 (= K157), P184 (= P183), G185 (= G184), I187 (≠ V186), T189 (= T188), M191 (≠ F190)
4i08A Crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg) from vibrio cholerae in complex with NADPH (see paper)
29% identity, 89% coverage: 3:226/252 of query aligns to 9:223/243 of 4i08A
- active site: G19 (= G13), N113 (= N112), S141 (= S140), Q151 (≠ G150), Y154 (= Y153), K158 (= K157)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G15 (= G9), S17 (≠ T11), R18 (≠ S12), I20 (= I14), T40 (≠ R34), N62 (≠ D60), V63 (= V61), N89 (= N87), A90 (= A88), G140 (= G139), S141 (= S140), Y154 (= Y153), K158 (= K157), P184 (= P183), G185 (= G184), T189 (= T188)
P0A2C9 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
31% identity, 89% coverage: 3:226/252 of query aligns to 6:224/244 of P0A2C9
- M125 (= M127) mutation to I: Loss of the temperature-sensitive phenotype; when associated with T-223.
- A223 (≠ V225) mutation to T: Loss of the temperature-sensitive phenotype; when associated with I-125.
- S224 (= S226) mutation to F: Distorts the local conformation and prevent stacking around Phe-221. The S224F mutation would additionally disrupt the hydrogen bond formed between Ser-224 and Glu-226.
1zemA Crystal structure of NAD+-bound xylitol dehydrogenase (see paper)
32% identity, 75% coverage: 2:190/252 of query aligns to 5:192/260 of 1zemA
- active site: N16 (≠ G13), S142 (= S140), Y155 (= Y153), K159 (= K157)
- binding nicotinamide-adenine-dinucleotide: G12 (= G9), G15 (≠ S12), N16 (≠ G13), I17 (= I14), D36 (≠ A33), M37 (≠ R34), D62 (= D60), V63 (= V61), N89 (= N87), A90 (= A88), G91 (= G89), T140 (≠ I138), S142 (= S140), Y155 (= Y153), K159 (= K157), P185 (= P183), M188 (≠ V186)
Sites not aligning to the query:
Query Sequence
>CA265_RS15110 FitnessBrowser__Pedo557:CA265_RS15110
MSKIALITGATSGIGEACAQTFAQQGYNLILLARREDRLAKIAHHLEDKYAITIKQVFAD
VRDKESLAAALEVLPAEWKKVDVLINNAGLSQGLDPIDKGDTNDWDTMIDTNVKGLLYVT
KIVSNWMIPNQSGHIINIGSIAGKEVYPNGNVYCASKHAVDALSKGMRIDLLPHGIKVTE
INPGMVETEFSVVRFKGDEDRAKKVYENLEPLIADDIADAIWYVVSRPKHVNINDMLIMP
TAQATATIINRV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory