SitesBLAST
Comparing CA265_RS15145 FitnessBrowser__Pedo557:CA265_RS15145 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5oqtA Crystal structure of a bacterial cationic amino acid transporter (cat) homologue (see paper)
44% identity, 73% coverage: 5:481/649 of query aligns to 1:418/456 of 5oqtA
- binding alanine: I38 (= I46), G40 (= G48), T41 (≠ A49), G42 (= G50), F226 (= F283), A227 (= A284), I229 (= I286)
- binding : E24 (≠ T32), G26 (= G34), F28 (≠ R36), D29 (= D37), M32 (≠ A40), A176 (≠ R233), R177 (≠ N234), A184 (≠ V241), A188 (= A245), L192 (= L249), Q294 (≠ L351), V297 (≠ M354)
6f34A Crystal structure of a bacterial cationic amino acid transporter (cat) homologue bound to arginine. (see paper)
44% identity, 74% coverage: 4:481/649 of query aligns to 2:420/458 of 6f34A
- binding arginine: I40 (= I46), G42 (= G48), T43 (≠ A49), G44 (= G50), E115 (= E120), Y116 (= Y121), A119 (≠ G124), F228 (= F283), A229 (= A284), I231 (= I286), V314 (= V369)
- binding cholesterol: W201 (≠ F256), Y202 (= Y257)
- binding : G28 (= G34), F30 (≠ R36), D31 (= D37), M34 (≠ A40), A178 (≠ R233), R179 (≠ N234), A186 (≠ V241), I187 (≠ V242), A190 (= A245), L194 (= L249), Q296 (≠ L351), V299 (≠ M354)
P30825 High affinity cationic amino acid transporter 1; CAT-1; CAT1; Ecotropic retroviral leukemia receptor homolog; Ecotropic retrovirus receptor homolog; Solute carrier family 7 member 1; System Y+ basic amino acid transporter from Homo sapiens (Human) (see paper)
30% identity, 70% coverage: 3:454/649 of query aligns to 11:435/629 of P30825
- N226 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
P76037 Putrescine importer PuuP from Escherichia coli (strain K12) (see paper)
23% identity, 65% coverage: 26:446/649 of query aligns to 15:381/461 of P76037
- Y110 (= Y121) mutation to X: The uptake activity is reduced to one-eighth of that of wild-type.
P0AAF1 Putrescine transporter PotE; Putrescine-proton symporter / putrescine-ornithine antiporter from Escherichia coli (strain K12) (see 2 papers)
23% identity, 32% coverage: 256:462/649 of query aligns to 176:387/439 of P0AAF1
- W201 (≠ F283) mutation W->F,L,Y: Strong decrease in both uptake and excretion activities.
- E207 (≠ D289) mutation E->A,D,N,Q: Lack of both uptake and excretion activities.
- C210 (≠ S292) mutation to A: Moderate decrease in both uptake and excretion activities.
- C285 (≠ M366) mutation to A: Moderate decrease in both uptake and excretion activities.
- C286 (≠ A367) mutation to A: Moderate decrease in both uptake and excretion activities.
- W292 (≠ F373) mutation W->F,L,Y: Strong decrease in both uptake and excretion activities.
- K301 (≠ M382) mutation to A: Excretion activity decreases more than uptake activity.
- Y308 (≠ L389) mutation to L: Excretion activity decreases more than uptake activity.
Sites not aligning to the query:
- 62 mutation C->A,T: Strong decrease in both uptake and excretion activities.; C→S: Moderate decrease in both uptake and excretion activities.
- 68 K→A: Slight decrease in both uptake and excretion activities.
- 77 mutation E->A,D,N,Q: Strong decrease in both uptake and excretion activities.
- 78 Y→L: Uptake activity decreases more than excretion activity.
- 82 K→A: Slight decrease in both uptake and excretion activities.
- 90 Y→L: Uptake activity decreases more than excretion activity.
- 92 Y→L: Moderate decrease in both uptake and excretion activities.
- 422 W→L: Uptake activity decreases more than excretion activity.
- 425 Y→F: Moderate decrease in both uptake and excretion activities.; Y→L: Strong decrease in both uptake and excretion activities.
- 433 mutation E->A,D,N,Q: Strong decrease in both uptake and excretion activities.
Q7YQK4 Large neutral amino acids transporter small subunit 1; 4F2 light chain; 4F2 LC; 4F2LC; L-type amino acid transporter 1; LAT1; Solute carrier family 7 member 5 from Oryctolagus cuniculus (Rabbit) (see 2 papers)
23% identity, 41% coverage: 256:521/649 of query aligns to 227:502/503 of Q7YQK4
- W234 (= W263) mutation to L: Decreased KM and Vmax for Trp. Increased KM but decreased Vmax for Phe. Increased KM and Vmax for Phe; when associated with D-219.
- C331 (≠ M366) mutation to S: No significant effect on inhibition by HgCl(2). Increased KM and Vmax for Phe.
- C377 (≠ L424) mutation to S: No significant effect on inhibition by HgCl(2).
- C403 (vs. gap) mutation to S: No significant effect on inhibition by HgCl(2).
- C439 (≠ I479) mutation to S: Prevents insertion into the plasma membrane and possibly protein folding.
- C454 (vs. gap) mutation to S: No significant effect on inhibition by HgCl(2). Slightly increased KM but slightly decreased Vmax for Phe.
- C492 (≠ S511) mutation to S: No significant effect on inhibition by HgCl(2). Slightly decreased KM and Vmax for Phe.
Sites not aligning to the query:
- 88 C→S: No significant effect on inhibition by HgCl(2). Decreased KM and Vmax for Phe. Similar affect on KM and Vmax for Phe; when associated with S-183.
- 98 C→S: No significant effect on inhibition by HgCl(2). Slightly decreased KM and Vmax for Phe. Slightly less decreased KM and Vmax for Phe; when associated with S-183.
- 160 C→S: No change to KM or Vmax for Phe.
- 172 C→S: No change to KM or Vmax for Phe.
- 174 C→S: No change to KM or Vmax for Phe.
- 183 C→S: No significant effect on inhibition by HgCl(2). Slightly decreased KM and Vmax for Phe. Similar affect on KM and Vmax for Phe; when associated with S-88. Slightly less decreased KM and Vmax for Phe; when associated with S-98.
- 219 G→D: Decreased KM and Vmax for Trp. Increased KM and Vmax for Phe; when associated with L-234.
O34739 Serine/threonine exchanger SteT from Bacillus subtilis (strain 168) (see paper)
26% identity, 28% coverage: 280:463/649 of query aligns to 200:387/438 of O34739
- C291 (≠ A365) mutation to S: Retains 25% of the transport activity; when associated with S-94; S-141; S-168 and S-415.
Sites not aligning to the query:
- 94 C→S: Retains 25% of the transport activity; when associated with S-141; S-168; S-291 and S-415.
- 141 C→S: Retains 25% of the transport activity; when associated with S-94; S-168; S-291 and S-415.
- 168 C→S: Retains 25% of the transport activity; when associated with S-94; S-141; S-291 and S-415.
- 415 C→S: Retains 25% of the transport activity; when associated with S-94; S-141; S-168 and S-291.
P82251 b(0,+)-type amino acid transporter 1; b(0,+)AT1; Glycoprotein-associated amino acid transporter b0,+AT1; Solute carrier family 7 member 9 from Homo sapiens (Human) (see 11 papers)
22% identity, 73% coverage: 5:481/649 of query aligns to 6:423/487 of P82251
- V40 (≠ I43) to M: in CSNU; uncertain significance
- IIGSG 43:47 (≠ IIGAG 46:50) binding
- I44 (= I47) to T: in CSNU; type I; dbSNP:rs121908485
- S51 (vs. gap) to F: in CSNU; uncertain significance
- P52 (vs. gap) to L: in CSNU; impairs protein stability and dimer formation; dbSNP:rs1198613438
- A70 (≠ I71) to V: in CSNU; partial loss of amino acid transport activity; dbSNP:rs769448665
- Y99 (= Y100) to H: in CSNU; uncertain significance
- G105 (= G106) to R: in CSNU; type III; severe loss of amino acid transport activity; dbSNP:rs121908480
- W114 (= W115) to R: in CSNU; uncertain significance
- I120 (≠ E120) to L: in CSNU; uncertain significance
- T123 (≠ I123) to M: in CSNU; partial loss of amino acid transport activity; dbSNP:rs79987078
- V142 (≠ T142) to A: no effect on amino acid transport activity; dbSNP:rs12150889
- C144 (≠ K144) modified: Interchain (with C-114 in SLC3A1)
- V170 (≠ L186) to M: in CSNU; type III; severe loss of amino acid transport activity; dbSNP:rs121908479
- A182 (= A200) to T: in CSNU; type III; partial loss of amino acid transport activity; dbSNP:rs79389353
- G195 (≠ W223) to R: in CSNU; type III; decreased amino acid transport activity; dbSNP:rs121908482
- L223 (= L251) to M: slightly decreased amino acid transport activity; dbSNP:rs1007160
- A224 (= A252) to V: in CSNU; non-classic type I; dbSNP:rs140873167
- N227 (= N269) to D: in CSNU; decreased amino acid transport activity
- W230 (≠ F283) to R: in CSNU; complete loss of amino acid transport activity; mutation to A: Abolishes amino acid transport activity.
- D233 (≠ I286) binding ; mutation to A: Complete loss of amino acid transport activity.
- W235 (≠ F288) mutation to A: Complete loss of amino acid transport activity.
- Q237 (≠ A290) mutation to A: Reduces amino acid transport activity.
- G259 (≠ A312) to R: in CSNU; type III; impairs protein stability and dimer formation; dbSNP:rs121908483
- P261 (≠ I314) to L: in CSNU; types I and III; dbSNP:rs121908486
- S286 (≠ G339) to F: in CSNU; uncertain significance; dbSNP:rs755135545
- C321 (≠ V372) mutation to S: Does not affect amino acid transport activity.
- A324 (≠ M375) to E: in CSNU; uncertain significance
- V330 (≠ S383) to M: in CSNU; type III; dbSNP:rs201618022
- A331 (≠ M384) to V: in CSNU; non-classic type I; dbSNP:rs768466784
- R333 (= R386) to Q: in CSNU; decreased amino acid transport activity; dbSNP:rs769576205; to W: in CSNU; severe loss of amino acid transport activity; dbSNP:rs121908484
- A354 (= A407) to T: in CSNU; type III; severe loss of amino acid transport activity; dbSNP:rs939028046
- S379 (= S432) mutation to A: Markedly reduces amino acid transport activity.
- A382 (≠ T435) to T: in CSNU; severe loss of amino acid transport activity; dbSNP:rs774878350
- W383 (≠ L436) mutation to A: Complete loss of amino acid transport activity.
- Y386 (≠ F439) mutation to A: Loss of amino acid transport activity.
- K401 (≠ P453) to E: in CSNU; uncertain significance; dbSNP:rs760264924
Sites not aligning to the query:
- 426 L → P: in CSNU; uncertain significance
- 482 P → L: in CSNU; severe loss of amino acid transport activity; no effect on localization to the apical membrane; dbSNP:rs146815072; mutation P->A,G,S,V: No effect on amino acid transport activity.; mutation P->F,I,M,W: Decreased amino acid transport activity.
7dsqB Overall structure of the lat1-4f2hc bound with 3,5-diiodo-l-tyrosine (see paper)
26% identity, 31% coverage: 259:457/649 of query aligns to 180:384/464 of 7dsqB
Sites not aligning to the query:
7dsnB Overall structure of the lat1-4f2hc bound with jx-119 (see paper)
26% identity, 31% coverage: 259:457/649 of query aligns to 180:384/464 of 7dsnB
Sites not aligning to the query:
- binding (2~{S})-2-azanyl-7-[[2-(1,3-benzoxazol-2-yl)phenyl]methoxy]-3,4-dihydro-1~{H}-naphthalene-2-carboxylic acid: 19, 20, 22, 23, 24, 97, 104
- binding cholesterol hemisuccinate: 109, 145, 148, 153, 457
7dslB Overall structure of the lat1-4f2hc bound with jx-078 (see paper)
26% identity, 31% coverage: 259:457/649 of query aligns to 180:384/464 of 7dslB
Sites not aligning to the query:
7dskB Overall structure of the lat1-4f2hc bound with jx-075 (see paper)
26% identity, 31% coverage: 259:457/649 of query aligns to 180:384/464 of 7dskB
Sites not aligning to the query:
- binding (2~{S})-2-azanyl-7-(naphthalen-1-ylmethoxy)-3,4-dihydro-1~{H}-naphthalene-2-carboxylic acid: 19, 20, 23, 24, 97, 100, 101
- binding cholesterol hemisuccinate: 148, 149, 153, 157, 457
6irtB Human lat1-4f2hc complex bound with bch (see paper)
26% identity, 31% coverage: 259:457/649 of query aligns to 173:377/457 of 6irtB
Sites not aligning to the query:
Q01650 Large neutral amino acids transporter small subunit 1; 4F2 light chain; 4F2 LC; 4F2LC; CD98 light chain; Integral membrane protein E16; E16; L-type amino acid transporter 1; hLAT1; Solute carrier family 7 member 5; y+ system cationic amino acid transporter from Homo sapiens (Human) (see 3 papers)
26% identity, 31% coverage: 259:457/649 of query aligns to 223:427/507 of Q01650
- D223 (= D259) to V: in dbSNP:rs17853937
- N230 (vs. gap) to K: in dbSNP:rs1060250
- A246 (≠ G277) mutation to V: Nearly abolishes leucine transport activity.
- F252 (= F283) mutation to A: Nearly abolishes leucine transport activity.
- W257 (≠ F288) mutation to A: Nearly abolishes leucine transport activity.
- N258 (≠ D289) mutation to A: Decreased leucine transport activity.; mutation to D: Nearly abolishes leucine transport activity.
- Y259 (≠ A290) mutation to A: Strongly decreased leucine transport activity.
- E303 (≠ D334) mutation to K: Decreased leucine transport activity.
- P375 (= P418) mutation to L: Nearly abolishes leucine transport activity.
Sites not aligning to the query:
- 117 Y→A: Strongly decreased leucine transport activity.
- 164 modified: Interchain (with C-210 in SLC3A2)
- 483:507 mutation Missing: Nearly abolishes leucine transport activity.
Q22397 Amino acid transporter protein 6 from Caenorhabditis elegans (see paper)
24% identity, 26% coverage: 241:410/649 of query aligns to 175:351/523 of Q22397
Sites not aligning to the query:
- 521:523 PDZ-binding motif; mutation Missing: Abolishes the interaction with nrfl-1.
Q9UHI5 Large neutral amino acids transporter small subunit 2; L-type amino acid transporter 2; hLAT2; Solute carrier family 7 member 8 from Homo sapiens (Human) (see 3 papers)
22% identity, 36% coverage: 222:457/649 of query aligns to 173:418/535 of Q9UHI5
- W174 (= W223) mutation to A: Does not affect protein expression, plasma membrane localization, or L-alanine uptake.
- F243 (= F283) mutation to A: Abolishes leucine and tryptophan transport activities.
- G246 (≠ I286) Important for substrate specificity; binding ; mutation to S: Strong decrease in the uptake of large substrates L-tryptophan, L-glutamine, and L-histidine but increases the uptake of small neutral amino acids glycine and L-alanine.
- V302 (≠ L342) to I: found in a patient with age-related hearing loss; does not affect L-alanine transport activity. Decreases L-tyrosine transport activity
- N395 (≠ G434) binding ; mutation to Q: Strongly reduces L-leucine uptake activity. Strongly reduces L-tryptophan uptake activity.
- Y396 (≠ T435) mutation to A: Strongly reduces L-leucine uptake activity.
- T402 (≠ L441) to M: found in a patient with age-related hearing loss; strongly decreased L-alanine transport activity. Decreases L-tyrosine transport activity
- R418 (= R457) to C: found in a patient with age-related hearing loss; decreases L-alanine transport activity. Decreases L-tyrosine transport activity
Sites not aligning to the query:
- 53 binding
- 93 Y→A: Nearly complete reduction of glycine, L-alanine, and L-glutamine uptake. Minimal effect on the transport of L-isoleucine, L-histidine and L-tryptophan.
- 134 Important for substrate specificity; binding ; N→Q: Reduces L-leucine uptake activity. Abolishes L-tryptophan uptake.; N→S: The substrate specificity changed dramatically reducing L-glutamine, glycine and L-alanine uptake activity thus mimicking the selectivity of SLC7A5.
- 154 modified: Interchain (with C-210 in SLC3A2)
- 460 V → E: found in a patient with age-related hearing loss; strongly decreases L-alanine transport activity. Decreases L-tyrosine transport activity. Decreases cell membrane localization
7b00A Human lat2-4f2hc complex in the apo-state (see paper)
22% identity, 36% coverage: 222:457/649 of query aligns to 133:378/457 of 7b00A
Sites not aligning to the query:
Q9QXW9 Large neutral amino acids transporter small subunit 2; L-type amino acid transporter 2; mLAT2; Solute carrier family 7 member 8 from Mus musculus (Mouse) (see paper)
22% identity, 36% coverage: 222:457/649 of query aligns to 172:417/531 of Q9QXW9
- F242 (= F283) mutation to W: Increases T2 import. Does not affect T3 import. Does not affect L-leucine and L-phenylalanine uptake.
Sites not aligning to the query:
- 130 Y→A: Increases T2 import. Increases T3 and enables T4 import. Does not affect L-leucine and L-phenylalanine uptake.
- 133 N→S: Increases T2 import. Does not affect T3 import. Does not affect L-leucine and L-phenylalanine uptake. Increases the export of both L-leucine and L-phenylalanine.
7cmiB The lat2-4f2hc complex in complex with leucine (see paper)
22% identity, 36% coverage: 222:457/649 of query aligns to 133:378/458 of 7cmiB
Sites not aligning to the query:
7cmhB The lat2-4f2hc complex in complex with tryptophan (see paper)
22% identity, 36% coverage: 222:457/649 of query aligns to 133:378/458 of 7cmhB
Sites not aligning to the query:
Query Sequence
>CA265_RS15145 FitnessBrowser__Pedo557:CA265_RS15145
MFEKLFRKKSISKILQDAAKGYGDHENTLHKTLGVRDLTAFGIAAIIGAGIFSTIGKASA
DGGPAVIFLFIFTAVACSFAAFAYAEFASMVPVSGSAYTYSYVAFGELVAWIIGWSLIME
YSIGNITVAISWSDYFTGLLSTIKIPPLGIEGIHVPDWMTMDYLSAYNGHKHAEALLAAG
KNLADLDSATALANNAWLTAPKIGSFHLVADIPALGIIILITWLIYRGMKESRNASNAMV
VVKLAVILLVLAVGIFYVDTKNWDPFAPNGVSGVLKGVSAVFFAYIGFDAISTTAEECKN
PQRDLPRGMMWAIIICTILYVAIALVLTGIVKSDTLAVGDPLAFVFDQINLKLMSGIIAV
SAVFAMASVLLVFQMGQPRIWMSMSRDGLLPKSFSKIHPKYKTPSFATIVVGFVVAVPSL
FMNLTIVTDLCSIGTLFAFVLVCAGVLVLQNRPDVQRGKFKIPYVNSKFIIPVVLIATII
FAFTKYGKETKAFFFNSPKTIQTVTFVTSLSGDELKIVKEEIVKNAAPQIILAEKVDAES
YLSALPADRYEQFISASKVPVEKKYESGWGLFKHKIPMWIFLIICVIITYYCITKNLSLI
PVLGLISCLYMMCELGISNWIGFGIWLVVGLVVYFAYGYRHSKLAKIES
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory