Comparing CA265_RS15165 FitnessBrowser__Pedo557:CA265_RS15165 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 19 hits to proteins with known functional sites (download)
6sbiA X-ray structure of murine fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate (see paper)
46% identity, 99% coverage: 3:203/203 of query aligns to 14:214/216 of 6sbiA
Q6P587 Acylpyruvase FAHD1, mitochondrial; Fumarylacetoacetate hydrolase domain-containing protein 1; FAH domain-containing protein 1; Oxaloacetate decarboxylase; OAA decarboxylase; YisK-like protein; EC 3.7.1.5; EC 4.1.1.112 from Homo sapiens (Human) (see 3 papers)
43% identity, 99% coverage: 3:203/203 of query aligns to 20:220/224 of Q6P587
6fogA X-ray structure of homo sapiens fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate at 1.94a resolution. (see paper)
43% identity, 99% coverage: 3:203/203 of query aligns to 15:215/218 of 6fogA
Sites not aligning to the query:
3v77A Crystal structure of a putative fumarylacetoacetate isomerase/hydrolase from oleispira antarctica (see paper)
39% identity, 99% coverage: 2:201/203 of query aligns to 17:220/224 of 3v77A
6j5yA Crystal structure of fumarylpyruvate hydrolase from pseudomonas aeruginosa in complex with mn2+ and pyruvate (see paper)
35% identity, 99% coverage: 2:202/203 of query aligns to 25:230/233 of 6j5yA
1nkqA Crystal structure of yeast ynq8, a fumarylacetoacetate hydrolase family protein
35% identity, 94% coverage: 2:192/203 of query aligns to 10:222/247 of 1nkqA
8gstC Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Pyruvate bound-form) (see paper)
35% identity, 95% coverage: 2:193/203 of query aligns to 72:269/290 of 8gstC
8gsrA Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Apo-form) (see paper)
35% identity, 95% coverage: 2:193/203 of query aligns to 72:269/290 of 8gsrA
3qdfA Crystal structure of 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase from mycobacterium marinum (see paper)
32% identity, 99% coverage: 2:202/203 of query aligns to 63:247/252 of 3qdfA
8sutA Crystal structure of yisk from bacillus subtilis in complex with reaction product 4-hydroxy-2-oxoglutaric acid (see paper)
32% identity, 94% coverage: 3:193/203 of query aligns to 95:292/303 of 8sutA
8skyB Crystal structure of yisk from bacillus subtilis in complex with oxalate (see paper)
32% identity, 94% coverage: 3:193/203 of query aligns to 94:291/303 of 8skyB
1gttA Crystal structure of hpce (see paper)
34% identity, 87% coverage: 3:179/203 of query aligns to 225:391/421 of 1gttA
6j5xB Crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate (see paper)
33% identity, 88% coverage: 2:180/203 of query aligns to 69:247/280 of 6j5xB
6j5xA Crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate (see paper)
33% identity, 88% coverage: 2:180/203 of query aligns to 69:247/280 of 6j5xA
6v77B Crystal structure of a putative hpce protein from mycobacterium smegmatis
31% identity, 95% coverage: 2:194/203 of query aligns to 71:267/279 of 6v77B
4dbhA Crystal structure of cg1458 with inhibitor (see paper)
32% identity, 95% coverage: 2:194/203 of query aligns to 63:258/269 of 4dbhA
6iymA Fumarylacetoacetate hydrolase (eafah) from psychrophilic exiguobacterium antarcticum (see paper)
30% identity, 99% coverage: 3:203/203 of query aligns to 71:275/277 of 6iymA
3r6oA Crystal structure of a probable 2-hydroxyhepta-2,4-diene-1, 7- dioateisomerase from mycobacterium abscessus (see paper)
31% identity, 93% coverage: 2:190/203 of query aligns to 64:248/265 of 3r6oA
6jvwB Crystal structure of maleylpyruvate hydrolase from sphingobium sp. Syk-6 in complex with manganese (ii) ion and pyruvate (see paper)
28% identity, 99% coverage: 2:202/203 of query aligns to 78:260/264 of 6jvwB
>CA265_RS15165 FitnessBrowser__Pedo557:CA265_RS15165
MKIIAIGRNYAEHAKELNNPVPTTPVIFLKPDTAVLKDNKPFYLPDFSDDVHYELEVVLK
ICKEGKHIAEKFAANYYDEVGLGIDFTARDIQSKHKEKGLPWELAKAFDNSAPISIFHPK
SDFEDLYNLNFELKINGERRQVGHTKDLLFSFEKIISFVSQYITLKKGDLIFTGTPQGVG
KINKGDKLEAWLEGKQLLNFDVK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory