Comparing CA265_RS15185 FitnessBrowser__Pedo557:CA265_RS15185 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6yakDDD C-terminal component of the split chain transketolase (see paper)
50% identity, 97% coverage: 12:318/318 of query aligns to 5:311/311 of 6yakDDD
6rjbB Human transketolase variant t382e (see paper)
34% identity, 99% coverage: 1:316/318 of query aligns to 305:621/622 of 6rjbB
Sites not aligning to the query:
8waaA Human transketolase soaked with donor ketose d-xylulose
34% identity, 99% coverage: 1:314/318 of query aligns to 305:619/620 of 8waaA
Sites not aligning to the query:
8wa9A Human transketolase soaked with donor ketose d-fructose
34% identity, 99% coverage: 1:314/318 of query aligns to 305:619/620 of 8wa9A
Sites not aligning to the query:
4kxyA Human transketolase in complex with thdp analogue (r)-2-(1,2- dihydroxyethyl)-3-deaza-thdp (see paper)
34% identity, 99% coverage: 1:314/318 of query aligns to 305:619/620 of 4kxyA
Sites not aligning to the query:
4kxvA Human transketolase in covalent complex with donor ketose d-xylulose- 5-phosphate, crystal 1 (see paper)
34% identity, 99% coverage: 1:314/318 of query aligns to 305:619/620 of 4kxvA
Sites not aligning to the query:
4kxuA Human transketolase in covalent complex with donor ketose d-fructose- 6-phosphate (see paper)
34% identity, 99% coverage: 1:314/318 of query aligns to 305:619/620 of 4kxuA
Sites not aligning to the query:
6ha3A Human transketolase variant e160q in covalent complex with donor ketose d-fructose-6-phosphate (see paper)
34% identity, 99% coverage: 1:314/318 of query aligns to 305:619/620 of 6ha3A
Sites not aligning to the query:
4kxxA Human transketolase in covalent complex with donor ketose d- sedoheptulose-7-phosphate (see paper)
34% identity, 99% coverage: 1:314/318 of query aligns to 306:620/621 of 4kxxA
Sites not aligning to the query:
8a4dA 1-deoxy-d-xylulose 5-phosphate synthase from pseudomonas aeruginosa with a thiamine analog inhibitor (see paper)
30% identity, 95% coverage: 14:316/318 of query aligns to 266:564/564 of 8a4dA
Sites not aligning to the query:
8a45F Structural analysis of 1-deoxy-d-xylulose 5-phosphate synthase from pseudomonas aeruginosa with 2-acetyl thiamine diphosphate (see paper)
30% identity, 94% coverage: 14:312/318 of query aligns to 277:571/573 of 8a45F
Sites not aligning to the query:
8a5kA Structural analysis of 1-deoxy-d-xylulose 5-phosphate synthase from pseudomonas aeruginosa and klebsiella pneumoniae reveals conformational changes upon cofactor binding (see paper)
30% identity, 94% coverage: 14:312/318 of query aligns to 266:560/562 of 8a5kA
Sites not aligning to the query:
P77488 1-deoxy-D-xylulose-5-phosphate synthase; 1-deoxyxylulose-5-phosphate synthase; DXP synthase; DXPS; EC 2.2.1.7 from Escherichia coli (strain K12) (see 2 papers)
30% identity, 92% coverage: 16:306/318 of query aligns to 325:611/620 of P77488
Sites not aligning to the query:
2o1sA 1-deoxy-d-xylulose 5-phosphate synthase (dxs) from escherichia coli (see paper)
30% identity, 92% coverage: 16:306/318 of query aligns to 241:527/536 of 2o1sA
Sites not aligning to the query:
2o1sB 1-deoxy-d-xylulose 5-phosphate synthase (dxs) from escherichia coli (see paper)
30% identity, 92% coverage: 16:306/318 of query aligns to 197:483/493 of 2o1sB
Sites not aligning to the query:
8bzxA 1-deoxy-d-xylulose 5-phosphate synthase from klebsiella pneumoniae (kpdxps),co-crystal with thiamine monophosphate analog (see paper)
30% identity, 92% coverage: 16:306/318 of query aligns to 251:537/546 of 8bzxA
Sites not aligning to the query:
8bzxB 1-deoxy-d-xylulose 5-phosphate synthase from klebsiella pneumoniae (kpdxps),co-crystal with thiamine monophosphate analog (see paper)
30% identity, 92% coverage: 16:306/318 of query aligns to 273:559/568 of 8bzxB
Sites not aligning to the query:
Q9RUB5 1-deoxy-D-xylulose-5-phosphate synthase; 1-deoxyxylulose-5-phosphate synthase; DXP synthase; DXPS; EC 2.2.1.7 from Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1) (see paper)
28% identity, 96% coverage: 3:306/318 of query aligns to 315:614/629 of Q9RUB5
Sites not aligning to the query:
8a9cB Structure of truncated 1-deoxy-d-xylulose 5-phosphate synthase (dxs) from klebsiella pneumoniae in complex with cofactor tpp
30% identity, 92% coverage: 16:306/318 of query aligns to 226:512/520 of 8a9cB
Sites not aligning to the query:
6xxgAAA 1-deoxy-D-xylulose-5-phosphate synthase,1-deoxy-D-xylulose-5-phosphate synthase (see paper)
28% identity, 96% coverage: 3:306/318 of query aligns to 249:548/560 of 6xxgAAA
Sites not aligning to the query:
>CA265_RS15185 FitnessBrowser__Pedo557:CA265_RS15185
MKKYTYTEKKDTRSGFGAGLHEAGKKNENVVALCADLVGSLKMDAFIKDFPERFTQVGIA
EANMIGIAAGMTIGGKIPFTGTFANFSTGRVYDQIRQSVAYSNKNVKICASHAGLTLGED
GATHQILEDIGLMKMLPGMVVINPCDYNQTKAATMAIAEYEGPVYLRFGRPVIPVFTDPD
QKFEIGKAWMVNEGTDVTIIATGHMVWKAIEAGEKLAELGIDAEIINIHTIKPLDDEAIL
KSVKKTGCVVTCEEHNKFGGLGESVARLLTTELPTPQEFVATNDTFGESGTPDQLMSKYG
LDAVNIVEAVQKVIGRKK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory