Comparing CA265_RS15205 CA265_RS15205 aspartate aminotransferase family protein to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P42588 Putrescine aminotransferase; PAT; PATase; Cadaverine transaminase; Diamine transaminase; Putrescine transaminase; Putrescine--2-oxoglutaric acid transaminase; Putrescine:2-OG aminotransferase; EC 2.6.1.82; EC 2.6.1.29 from Escherichia coli (strain K12) (see paper)
41% identity, 95% coverage: 12:369/378 of query aligns to 76:443/459 of P42588
4uoxC Crystal structure of ygjg in complex with pyridoxal-5'-phosphate and putrescine (see paper)
41% identity, 95% coverage: 12:369/378 of query aligns to 74:441/456 of 4uoxC
Sites not aligning to the query:
4uoxA Crystal structure of ygjg in complex with pyridoxal-5'-phosphate and putrescine (see paper)
41% identity, 95% coverage: 12:369/378 of query aligns to 70:437/453 of 4uoxA
Sites not aligning to the query:
Q5SHH5 [LysW]-aminoadipate semialdehyde transaminase; EC 2.6.1.118 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
39% identity, 97% coverage: 2:368/378 of query aligns to 29:394/395 of Q5SHH5
1wkhA Acetylornithine aminotransferase from thermus thermophilus hb8
39% identity, 97% coverage: 2:368/378 of query aligns to 21:386/387 of 1wkhA
Sites not aligning to the query:
1wkgA Acetylornithine aminotransferase from thermus thermophilus hb8
39% identity, 97% coverage: 2:368/378 of query aligns to 21:386/387 of 1wkgA
Sites not aligning to the query:
1vefA Acetylornithine aminotransferase from thermus thermophilus hb8
39% identity, 97% coverage: 2:368/378 of query aligns to 21:386/387 of 1vefA
Sites not aligning to the query:
Q9M8M7 Acetylornithine aminotransferase, chloroplastic/mitochondrial; ACOAT; Acetylornithine transaminase; AOTA; Protein HOPW1-1-INTERACTING 1; EC 2.6.1.11 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
35% identity, 97% coverage: 8:374/378 of query aligns to 84:456/457 of Q9M8M7
Sites not aligning to the query:
8ht4B Crystal structure of acetylornithine aminotransferase complex with plp from corynebacterium glutamicum
38% identity, 98% coverage: 2:371/378 of query aligns to 19:389/390 of 8ht4B
O66442 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Aquifex aeolicus (strain VF5)
36% identity, 97% coverage: 2:367/378 of query aligns to 13:372/376 of O66442
2eh6A Crystal structure of acetylornithine aminotransferase from aquifex aeolicus vf5
36% identity, 97% coverage: 2:367/378 of query aligns to 12:371/375 of 2eh6A
Q9X2A5 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
36% identity, 97% coverage: 4:369/378 of query aligns to 14:380/385 of Q9X2A5
2ordA Crystal structure of acetylornithine aminotransferase (ec 2.6.1.11) (acoat) (tm1785) from thermotoga maritima at 1.40 a resolution
36% identity, 97% coverage: 4:369/378 of query aligns to 22:388/393 of 2ordA
A0QYS9 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
38% identity, 95% coverage: 2:360/378 of query aligns to 20:372/390 of A0QYS9
4ppmA Crystal structure of pige: a transaminase involved in the biosynthesis of 2-methyl-3-n-amyl-pyrrole (map) from serratia sp. Fs14 (see paper)
33% identity, 94% coverage: 4:360/378 of query aligns to 48:443/464 of 4ppmA
Sites not aligning to the query:
3nx3A Crystal structure of acetylornithine aminotransferase (argd) from campylobacter jejuni
34% identity, 97% coverage: 6:373/378 of query aligns to 17:387/388 of 3nx3A
A0A0J9X1Q5 Aminotransferase PigE; EC 2.6.1.- from Serratia sp. (strain FS14) (see paper)
36% identity, 84% coverage: 4:319/378 of query aligns to 419:744/853 of A0A0J9X1Q5
4jevB N-acetylornithine aminotransferase from s. Typhimurium complexed with gabaculine
34% identity, 98% coverage: 5:374/378 of query aligns to 24:398/402 of 4jevB
5e3kB Crystal structure of the ornithine aminotransferase from toxoplasma gondii me49 in a complex with (s)-4-amino-5-fluoropentanoic acid
34% identity, 98% coverage: 6:374/378 of query aligns to 42:419/424 of 5e3kB
Sites not aligning to the query:
5eqcA Structure of the ornithine aminotransferase from toxoplasma gondii crystallized in presence of oxidized glutathione reveals partial occupancy of plp at the protein active site
34% identity, 98% coverage: 6:374/378 of query aligns to 43:420/426 of 5eqcA
>CA265_RS15205 CA265_RS15205 aspartate aminotransferase family protein
MLEFVRAKGIYIYDAQNKKHIDLIAGIGVSNVGHCHPAVVKAIQEQAETYMHLMVYGEYV
QTPQVNFAKALADILPESLSCTYFLNSGTEAVEGAMKLAKRYTGRKGFIACKNAYHGSTQ
GAESLMESDFYSSGYGPFLPHVSFIEHNNLADLEKITNEIAAVFIEPIQGEAGIRVSDLS
YMQALRTKCTETGTLLIFDEIQSGFGRSGKMFAFEHYNVVPDVLLLAKGIGGGMPIGAFI
SSLEIMSVLSHTPILGHMTTFGGHPVCCAAGLATLRTLVDDHIVDEVEEKGQLFKQLLQH
PAIKEIRGKGLMLAVEFENFEINKKIIDACILDGVLSDWFLHCSNSMRIAPPLIITKEEI
AEACTIILKNVNSVFGSQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory