SitesBLAST
Comparing CA265_RS15345 FitnessBrowser__Pedo557:CA265_RS15345 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8grjB Crystal structure of gamma-alpha subunit complex from burkholderia cepacia fad glucose dehydrogenase in complex with gluconolactone
25% identity, 79% coverage: 117:562/567 of query aligns to 91:531/531 of 8grjB
- binding fe3-s4 cluster: C204 (= C228), C205 (≠ Q229), G206 (≠ Y230), N207 (≠ R231), N209 (≠ L233), C210 (= C234), C214 (= C238), P331 (≠ K378)
- binding flavin-adenine dinucleotide: T94 (≠ K120), H97 (≠ M123), W98 (= W124), A99 (≠ G125), S101 (≠ Q127), M211 (≠ S235), V242 (≠ I272), A277 (≠ G305), N278 (≠ S306), E281 (≠ G309), I285 (≠ V313), N467 (≠ M496), N511 (= N542), T513 (≠ S544)
- binding D-glucono-1,5-lactone: M211 (≠ S235), E333 (≠ D380), H355 (≠ E402), N466 (≠ G495), N467 (≠ M496), H468 (= H499), N511 (= N542)
Sites not aligning to the query:
7w2jD Cryo-em structure of membrane-bound fructose dehydrogenase from gluconobacter japonicus
23% identity, 97% coverage: 15:563/567 of query aligns to 4:537/537 of 7w2jD
- binding fe3-s4 cluster: R200 (vs. gap), C211 (= C228), G213 (≠ Y230), N214 (≠ R231), N215 (= N232), C217 (= C234), C221 (= C238), I223 (≠ F240), A225 (= A242), S338 (≠ R362)
- binding flavin-adenine dinucleotide: G9 (= G20), G11 (= G22), D32 (≠ E43), A33 (≠ R44), Y59 (= Y87), K97 (vs. gap), G101 (= G119), T102 (≠ K120), T103 (≠ S121), H105 (≠ M123), W106 (= W124), S109 (≠ Q127), V249 (≠ I272), A284 (≠ G305), N285 (≠ S306), E288 (≠ G309), K291 (≠ F312), L292 (≠ V313), N472 (≠ C492), N516 (= N542), S517 (≠ P543), T518 (≠ S544)
- binding heme c: P209 (≠ G226), I223 (≠ F240)
8jejA Cryo-em structure of na-dithionite reduced membrane-bound fructose dehydrogenase from gluconobacter japonicus
23% identity, 97% coverage: 15:563/567 of query aligns to 7:540/540 of 8jejA
- binding fe3-s4 cluster: R203 (vs. gap), C214 (= C228), C215 (≠ Q229), G216 (≠ Y230), N217 (≠ R231), N218 (= N232), N219 (≠ L233), C220 (= C234), C224 (= C238), I226 (≠ F240), M229 (≠ Y243), S341 (≠ R362)
- binding flavin-adenine dinucleotide: I11 (= I19), G12 (= G20), G14 (= G22), I15 (= I23), C16 (≠ S24), D35 (≠ E43), A36 (≠ R44), G97 (= G114), K100 (vs. gap), G101 (≠ H116), G104 (= G119), T105 (≠ K120), T106 (≠ S121), H108 (≠ M123), W109 (= W124), A110 (≠ G125), S112 (≠ Q127), M221 (≠ S235), A250 (≠ H270), V252 (≠ I272), A287 (≠ G305), N288 (≠ S306), E291 (≠ G309), N475 (≠ C492), H476 (= H499), N519 (= N542), T521 (≠ S544), M524 (≠ F547)
7qvaA Crystal structure of a bacterial pyranose 2-oxidase in complex with mangiferin (see paper)
27% identity, 29% coverage: 402:565/567 of query aligns to 291:455/457 of 7qvaA
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 11, 12, 14, 15, 16, 36, 37, 38, 97, 102, 103, 106, 107, 108, 110, 206, 207, 241, 242, 243, 246
- binding Mangiferin: 51, 73, 108
4mofA Pyranose 2-oxidase h450g mutant with 2-fluorinated glucose (see paper)
29% identity, 23% coverage: 426:557/567 of query aligns to 429:563/573 of 4mofA
Sites not aligning to the query:
- binding dihydroflavine-adenine dinucleotide: 7, 10, 11, 12, 31, 32, 113, 114, 118, 119, 122, 123, 124, 126, 238, 275, 279, 409
- binding 2-deoxy-2-fluoro-alpha-D-glucopyranose: 124, 403, 407, 411
3lsmA Pyranose 2-oxidase h167a mutant with flavin n(5) sulfite adduct (see paper)
29% identity, 23% coverage: 426:557/567 of query aligns to 430:564/574 of 3lsmA
- binding (s)-10-((2s,3s,4r)-5-((s)-((s)-(((2r,3s,4r,5r)-5-(6-amino-9h-purin-9-yl)-3,4-dihydroxy-tetrahydrofuran-2-yl)methoxy)(hydroxy)phosphoryloxy)(hydroxy)phosphoryloxy)-2,3,4-trihydroxypentyl)-7,8-dimethyl-2,4-dioxo-2,3,4,4a-tetrahydrobenzo[g]pteridine-5(10h)-sulfonic acid: H504 (= H499), N549 (= N542), T551 (≠ S544)
- binding sulfite ion: R527 (≠ Q520), G530 (≠ E523), K532 (≠ N525)
Sites not aligning to the query:
- binding alpha-D-glucopyranose: 19, 20, 157, 161, 566
- binding (s)-10-((2s,3s,4r)-5-((s)-((s)-(((2r,3s,4r,5r)-5-(6-amino-9h-purin-9-yl)-3,4-dihydroxy-tetrahydrofuran-2-yl)methoxy)(hydroxy)phosphoryloxy)(hydroxy)phosphoryloxy)-2,3,4-trihydroxypentyl)-7,8-dimethyl-2,4-dioxo-2,3,4,4a-tetrahydrobenzo[g]pteridine-5(10h)-sulfonic acid: 11, 12, 13, 32, 33, 114, 119, 120, 124, 125, 126, 127, 239, 276, 280, 428
- binding sulfite ion: 249
4molA Pyranose 2-oxidase h167a mutant with 2-fluorinated galactose (see paper)
29% identity, 23% coverage: 426:557/567 of query aligns to 429:563/573 of 4molA
Sites not aligning to the query:
- binding 2-deoxy-2-fluoro-beta-D-galactopyranose: 403, 407, 409, 411, 427
- binding flavin-adenine dinucleotide: 7, 10, 11, 12, 31, 32, 113, 115, 118, 119, 123, 124, 126, 238, 275, 279
3pl8A Pyranose 2-oxidase h167a complex with 3-deoxy-3-fluoro-beta-d-glucose (see paper)
29% identity, 23% coverage: 426:557/567 of query aligns to 429:563/573 of 3pl8A
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 7, 10, 11, 12, 31, 32, 113, 115, 118, 119, 123, 124, 126, 238, 275, 279
- binding 3-deoxy-3-fluoro-beta-D-glucopyranose: 124, 403, 407, 411
4mooA Pyranose 2-oxidase h450g mutant with 2-fluorinated galactose (see paper)
29% identity, 23% coverage: 426:557/567 of query aligns to 432:566/576 of 4mooA
Sites not aligning to the query:
- binding dihydroflavine-adenine dinucleotide: 10, 13, 14, 15, 34, 35, 116, 121, 122, 125, 126, 127, 128, 129, 241, 278, 282
- binding 2-deoxy-2-fluoro-alpha-D-galactopyranose: 127, 406, 410, 412, 414
4momA Pyranose 2-oxidase h450g mutant with 3-fluorinated galactose (see paper)
29% identity, 23% coverage: 426:557/567 of query aligns to 432:566/576 of 4momA
Sites not aligning to the query:
- binding 3-deoxy-3-fluoro-beta-D-galactopyranose: 127, 406, 410, 414
- binding dihydroflavine-adenine dinucleotide: 10, 13, 14, 15, 34, 35, 116, 121, 122, 125, 126, 127, 129, 241, 278
4moeA Pyranose 2-oxidase h450g mutant with 3-fluorinated glucose (see paper)
29% identity, 23% coverage: 426:557/567 of query aligns to 432:566/576 of 4moeA
Sites not aligning to the query:
- binding dihydroflavine-adenine dinucleotide: 10, 13, 14, 15, 34, 35, 117, 121, 122, 125, 126, 127, 128, 129, 241, 278
- binding 3-deoxy-3-fluoro-beta-D-glucopyranose: 127, 406, 410, 412, 414
3bg6A Pyranose 2-oxidase from trametes multicolor, e542k mutant (see paper)
29% identity, 23% coverage: 426:557/567 of query aligns to 432:566/577 of 3bg6A
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 10, 13, 14, 15, 34, 35, 116, 117, 118, 121, 122, 125, 126, 127, 129, 241, 278, 282
2f5vA Reaction geometry and thermostability mutant of pyranose 2-oxidase from the white-rot fungus peniophora sp. (see paper)
29% identity, 23% coverage: 426:557/567 of query aligns to 432:566/577 of 2f5vA
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 11, 13, 14, 15, 34, 35, 116, 121, 122, 125, 126, 127, 129, 241, 278, 282
- binding beta-D-arabino-hexopyranos-2-ulose: 127, 406, 410, 430
1tt0A Crystal structure of pyranose 2-oxidase (see paper)
29% identity, 23% coverage: 426:557/567 of query aligns to 432:566/577 of 1tt0A
Sites not aligning to the query:
- binding acetate ion: 412
- binding flavin-adenine dinucleotide: 10, 13, 14, 15, 34, 35, 116, 117, 118, 121, 122, 125, 126, 127, 129, 241, 278, 282
7qfdA Crystal structure of a bacterial pyranose 2-oxidase complex with d- glucose (see paper)
28% identity, 26% coverage: 421:565/567 of query aligns to 312:456/458 of 7qfdA
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 11, 14, 15, 16, 36, 37, 38, 101, 106, 107, 111, 112, 114, 210, 211, 246, 250
- binding alpha-D-glucopyranose: 77, 112
2igoA Crystal structure of pyranose 2-oxidase h167a mutant with 2-fluoro-2- deoxy-d-glucose (see paper)
29% identity, 23% coverage: 426:557/567 of query aligns to 432:566/577 of 2igoA
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 13, 14, 15, 34, 35, 116, 117, 118, 121, 122, 126, 127, 129, 241, 278
- binding 2-deoxy-2-fluoro-beta-D-glucopyranose: 127, 406
7qf8A Crystal structure of a bacterial pyranose 2-oxidase from pseudoarthrobacter siccitolerans (see paper)
28% identity, 26% coverage: 421:565/567 of query aligns to 346:490/494 of 7qf8A
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 11, 12, 14, 15, 16, 37, 38, 114, 119, 120, 124, 125, 127, 227, 261, 262, 263, 266, 331
Q6UG02 Pyranose 2-oxidase; P2Ox; POD; POx; PROD; Pyranose oxidase; FAD-oxidoreductase; Glucose 2-oxidase; Pyranose:oxygen 2-oxidoreductase; EC 1.1.3.10 from Phlebiopsis gigantea (White-rot fungus) (Peniophora gigantea) (see paper)
28% identity, 24% coverage: 426:563/567 of query aligns to 475:612/622 of Q6UG02
- E540 (≠ Y493) mutation to K: In P2OxB1; increases thermostability up to 70 degrees Celsius and enhances pH stability in alkaline solution. Increases the catalytic efficiency 3.1-fold for D-xylose and 7.3-fold for L-sorbose, mainly by lowering the Km values for these two substrates to 6.6 mM and 5.4 mM, respectively. In P2OxB2H; increases the catalytic efficiency 5.3-fold for D-glucose, 2-fold for methyl-beta-D-glucoside, 59.9-fold for D-xylose, 69-fold for L-sorbose and 4.8-fold for D-galactose; when associated with K-312.
Sites not aligning to the query:
- 167 H→C: Decreases activity by 90%.
- 312 K→E: In P2OxB2H; increases the catalytic efficiency 5.3-fold for D-glucose, 2-fold for methyl-beta-D-glucoside, 59.9-fold for D-xylose, 69-fold for L-sorbose and 4.8-fold for D-galactose; when associated with K-540.
P79076 Pyranose 2-oxidase; P2Ox; POD; POx; PROD; Pyranose oxidase; FAD-oxidoreductase; Glucose 2-oxidase; Pyranose:oxygen 2-oxidoreductase; EC 1.1.3.10 from Trametes versicolor (White-rot fungus) (Coriolus versicolor) (see paper)
28% identity, 23% coverage: 426:557/567 of query aligns to 474:608/623 of P79076
- E542 (≠ Y493) mutation to K: Increases thermostability up to 65 degrees Celsius and enhances pH stability in alkaline solution. Increases the catalytic efficiency 2-fold for D-glucose and 3-fold for 1,5-anhydro-D-glucitol, mainly by lowering the Km values for these two substrates to 0.74 mM and 14.3 mM, respectively.
Sites not aligning to the query:
- 28:38 modified: propeptide
4migA Pyranose 2-oxidase from phanerochaete chrysosporium, recombinant wild type (see paper)
25% identity, 23% coverage: 426:554/567 of query aligns to 433:561/570 of 4migA
Sites not aligning to the query:
- binding dihydroflavine-adenine dinucleotide: 10, 11, 12, 31, 32, 128, 129, 130, 133, 134, 137, 138, 139, 141, 262, 302, 306
- binding 3-deoxy-3-fluoro-beta-D-glucopyranose: 139, 407, 411, 415
Query Sequence
>CA265_RS15345 FitnessBrowser__Pedo557:CA265_RS15345
MMNLNTNLKAENTYDAIVIGSGISGGWAAKELTEKGLRVLMLERGMNIEHITGYETAMKN
PWDFKHAGKLTEEQKRTHPVQKRDYPYQEANEKWWVNDLECPYTEDKRFDWYRGFHVGGK
SLMWGRQSYRLSDHNFEDNARDGHGSDWPVRYAELSPWYDYAERFAGISGSKENWPTCPD
GQFLPPMDLNIVEKSVKARIEEHYKRERIMMIGRVANLTVPHKGRGNCQYRNLCSRGCPF
GAYFSTQSSTLPAAMATKRLTLRPYSIVNHIIYDKDTKKAKGVMVIDAETNKTMEFYAKI
VFVNGSTLGSTFVLLNSTSEAHPNGLGNGSGQLGHNLMDHHFRCGASGEAEGFDDKYTYG
RRANGIYIPRYQNIGNDKRDYLRGFGYQGGASRANWQGDVAELSFGADLKQKMTTPGKWS
MGLGGFGEMLPYYENKVYIDKTKKDKWGQPVLAIDCEYKENEKKMRVDMMNDAAEMLEKA
GMKNIKTFDNGCYPGMAIHEMGTARMGNDPKTSVLNKWNQMHEVNNVFVTDGSCMPSIAC
QNPSLTFMALTARACDYAVKELKKKNI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory