SitesBLAST
Comparing CA265_RS15365 FitnessBrowser__Pedo557:CA265_RS15365 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7xreC Crystal structure of dgpa
24% identity, 47% coverage: 57:285/485 of query aligns to 25:209/363 of 7xreC
- binding nicotinamide-adenine-dinucleotide: D38 (= D78), I39 (≠ V79), T78 (= T118), P79 (= P119), N80 (≠ D120), H83 (= H123), E100 (≠ Q140), K101 (= K141), P102 (= P142), F170 (= F234), Q176 (≠ P240), H187 (= H260)
Sites not aligning to the query:
3dtyA Crystal structure of an oxidoreductase from pseudomonas syringae
27% identity, 29% coverage: 54:195/485 of query aligns to 12:164/374 of 3dtyA
Sites not aligning to the query:
3ec7A Crystal structure of putative dehydrogenase from salmonella typhimurium lt2
27% identity, 29% coverage: 48:189/485 of query aligns to 3:146/336 of 3ec7A
- active site: K97 (= K141)
- binding nicotinamide-adenine-dinucleotide: G11 (= G55), M12 (≠ G56), I13 (≠ K57), D35 (= D78), I36 (≠ V79), R40 (= R83), T73 (≠ S117), A74 (≠ T118), S75 (≠ P119), N76 (≠ D120), H79 (= H123), E96 (≠ Q140), K97 (= K141), M126 (≠ Q169)
Sites not aligning to the query:
7xr9A Crystal structure of dgpa with glucose (see paper)
27% identity, 26% coverage: 78:203/485 of query aligns to 29:157/344 of 7xr9A
- binding beta-D-glucopyranose: K91 (= K141), R150 (= R200), W157 (= W203)
- binding nicotinamide-adenine-dinucleotide: D51 (= D99), Y52 (≠ W100), C67 (≠ S117), T68 (= T118), P69 (= P119), H73 (= H123), E90 (≠ Q140), K91 (= K141), P92 (= P142), Q119 (= Q169)
Sites not aligning to the query:
4mjlD Crystal structure of myo-inositol dehydrogenase from lactobacillus casei in complex with NAD and d-chiro-inositol
29% identity, 29% coverage: 49:189/485 of query aligns to 5:146/339 of 4mjlD
- active site: K97 (= K141)
- binding (1r,2r,3s,4s,5s,6s)-cyclohexane-1,2,3,4,5,6-hexol: K97 (= K141)
- binding nicotinamide-adenine-dinucleotide: G11 (= G55), A12 (≠ G56), M13 (≠ K57), D35 (= D78), I36 (≠ V79), V73 (≠ S117), S74 (≠ T118), H79 (= H123), E96 (≠ Q140), K97 (= K141), M126 (≠ Q169)
Sites not aligning to the query:
- binding (1r,2r,3s,4s,5s,6s)-cyclohexane-1,2,3,4,5,6-hexol: 155, 157, 172, 173, 176, 236
- binding nicotinamide-adenine-dinucleotide: 172, 274, 282
4mioD Crystal structure of myo-inositol dehydrogenase from lactobacillus casei in complex with NAD(h) and myo-inositol
29% identity, 29% coverage: 49:189/485 of query aligns to 5:146/339 of 4mioD
- active site: K97 (= K141)
- binding 1,2,3,4,5,6-hexahydroxy-cyclohexane: K97 (= K141)
- binding 1,4-dihydronicotinamide adenine dinucleotide: A12 (≠ G56), M13 (≠ K57), D35 (= D78), I36 (≠ V79), S74 (≠ T118), A78 (≠ N122), H79 (= H123), E96 (≠ Q140), K97 (= K141), M126 (≠ Q169)
Sites not aligning to the query:
- binding 1,2,3,4,5,6-hexahydroxy-cyclohexane: 155, 157, 172, 173, 176, 236
- binding 1,4-dihydronicotinamide adenine dinucleotide: 172, 274, 282
4mioA Crystal structure of myo-inositol dehydrogenase from lactobacillus casei in complex with NAD(h) and myo-inositol
29% identity, 29% coverage: 49:189/485 of query aligns to 5:146/339 of 4mioA
- active site: K97 (= K141)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G11 (= G55), A12 (≠ G56), M13 (≠ K57), D35 (= D78), I36 (≠ V79), S74 (≠ T118), F75 (≠ P119), H79 (= H123), E96 (≠ Q140), K97 (= K141)
Sites not aligning to the query:
4minA Crystal structure of myo-inositol dehydrogenase from lactobacillus casei with bound cofactor NAD
29% identity, 29% coverage: 49:189/485 of query aligns to 5:146/339 of 4minA
- active site: K97 (= K141)
- binding nicotinamide-adenine-dinucleotide: G11 (= G55), A12 (≠ G56), M13 (≠ K57), D35 (= D78), I36 (≠ V79), V73 (≠ S117), S74 (≠ T118), F75 (≠ P119), H79 (= H123), E96 (≠ Q140), K97 (= K141)
Sites not aligning to the query:
F0M433 Levoglucosan dehydrogenase; LGDH; 1,6-anhydro-beta-D-glucose dehydrogenase; PpLGDH; EC 1.1.1.425 from Pseudarthrobacter phenanthrenivorans (strain DSM 18606 / JCM 16027 / LMG 23796 / Sphe3) (Arthrobacter phenanthrenivorans) (see paper)
25% identity, 39% coverage: 76:263/485 of query aligns to 41:196/390 of F0M433
- E43 (≠ D78) binding
- T81 (= T118) binding
- N83 (≠ D120) binding
- H86 (= H123) binding
- E103 (≠ Q140) binding
- K104 (= K141) binding ; binding
- A130 (≠ G167) binding
- N132 (≠ Q169) binding
- Y133 (≠ G170) binding
- Q163 (= Q205) binding
- W175 (= W243) binding
- R176 (= R244) binding ; binding
- D189 (= D256) binding
- H193 (= H260) binding
Sites not aligning to the query:
- 13 binding
- 14 binding
- 335 binding
6a3jC Levoglucosan dehydrogenase, complex with nadh and l-sorbose (see paper)
25% identity, 39% coverage: 76:263/485 of query aligns to 39:194/378 of 6a3jC
- binding 1,4-dihydronicotinamide adenine dinucleotide: E41 (≠ D78), T79 (= T118), P80 (= P119), N81 (≠ D120), H84 (= H123), E101 (≠ Q140), K102 (= K141), W173 (= W243), R174 (= R244)
- binding alpha-L-sorbopyranose: K102 (= K141), Y131 (≠ G170), Y159 (≠ W203), Q161 (= Q205), W163 (= W222), R174 (= R244), D187 (= D256)
Sites not aligning to the query:
6a3iA Levoglucosan dehydrogenase, complex with nadh and levoglucosan (see paper)
25% identity, 39% coverage: 76:263/485 of query aligns to 40:195/372 of 6a3iA
- binding Levoglucosan: K103 (= K141), Y132 (≠ G170), Y160 (≠ W203), Q162 (= Q205), R175 (= R244), D188 (= D256), H192 (= H260)
- binding 1,4-dihydronicotinamide adenine dinucleotide: E42 (≠ D78), A43 (≠ V79), P81 (= P119), N82 (≠ D120), L84 (≠ N122), H85 (= H123), E102 (≠ Q140), K103 (= K141), W174 (= W243), R175 (= R244)
Sites not aligning to the query:
2glxA Crystal structure analysis of bacterial 1,5-af reductase (see paper)
36% identity, 16% coverage: 110:189/485 of query aligns to 62:141/332 of 2glxA
Sites not aligning to the query:
- active site: 179
- binding acetate ion: 179
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: 7, 8, 9, 10, 11, 32, 33, 37, 161, 162, 282
Q2I8V6 1,5-anhydro-D-fructose reductase; Anhydrofructose reductase; 1,5-anhydro-D-fructose reductase (1,5-anhydro-D-mannitol-forming); EC 1.1.1.292 from Ensifer adhaerens (Sinorhizobium morelense) (see paper)
36% identity, 16% coverage: 110:189/485 of query aligns to 63:142/333 of Q2I8V6
Sites not aligning to the query:
- 9:12 binding
- 10 S→G: Almost no effect.
- 13 A→G: Can use NAD as cosubstrate as well as NADP.
- 33 S→D: No activity.
- 33:34 binding
- 38 binding
- 162:163 binding
- 176 D→A: Less than 1% remaining activity.
- 180 H→A: Less than 2% remaining activity.
- 206 G→I: No effect.
- 283 binding
3e18A Crystal structure of NAD-binding protein from listeria innocua
21% identity, 50% coverage: 52:293/485 of query aligns to 9:210/348 of 3e18A
- active site: K94 (= K141), H178 (= H260)
- binding nicotinamide-adenine-dinucleotide: G12 (= G55), G13 (= G56), M14 (≠ K57), F34 (≠ C77), D35 (= D78), I36 (≠ V79), K40 (≠ R82), A70 (≠ S117), T71 (= T118), P72 (= P119), N73 (≠ D120), H76 (= H123), E93 (≠ Q140), K94 (= K141), N122 (≠ Q169), W161 (= W243), R162 (= R244), H178 (= H260)
4n54A Crystal structure of scyllo-inositol dehydrogenase from lactobacillus casei with bound cofactor NAD(h) and scyllo-inositol
28% identity, 22% coverage: 95:201/485 of query aligns to 52:157/340 of 4n54A
- active site: K96 (= K141)
- binding (1r,2r,3r,4r,5r,6r)-cyclohexane-1,2,3,4,5,6-hexol: K96 (= K141), D156 (≠ R200)
- binding 1,4-dihydronicotinamide adenine dinucleotide: S73 (≠ T118), P74 (= P119), F77 (≠ N122), H78 (= H123), E95 (≠ Q140), K96 (= K141), M125 (≠ Q169)
Sites not aligning to the query:
- active site: 183
- binding (1r,2r,3r,4r,5r,6r)-cyclohexane-1,2,3,4,5,6-hexol: 12, 179, 180, 183, 238, 244
- binding 1,4-dihydronicotinamide adenine dinucleotide: 8, 9, 10, 11, 12, 13, 35, 36, 40, 167, 284
3rc1A Crystal structure of kijd10, a 3-ketoreductase from actinomadura kijaniata incomplex with NADP and tdp-benzene (see paper)
32% identity, 21% coverage: 107:206/485 of query aligns to 61:160/325 of 3rc1A
Sites not aligning to the query:
- active site: 179
- binding nadp nicotinamide-adenine-dinucleotide phosphate: 10, 11, 12, 13, 35, 36, 56, 162, 163, 168, 175, 179
- binding phosphate ion: 278, 283
- binding 5'-O-[(S)-hydroxy{[(S)-hydroxy(phenoxy)phosphoryl]oxy}phosphoryl]thymidine: 16, 17, 233, 253
B3TMR8 dTDP-3,4-didehydro-2,6-dideoxy-alpha-D-glucose 3-reductase; 3-ketoreductase; NADPH-dependent C3-ketoreductase; EC 1.1.1.384 from Actinomadura kijaniata (see paper)
32% identity, 21% coverage: 107:206/485 of query aligns to 68:167/332 of B3TMR8
- L79 (≠ T118) binding
- H84 (= H123) binding
- K102 (= K141) active site, Proton donor; mutation K->A,M,Q: Loss of reductase activity.; mutation to E: Retains some activity, but the catalytic efficiency is strongly reduced.
Sites not aligning to the query:
- 17:23 binding
- 42:43 binding
- 63 binding
- 170 binding
- 182 binding
- 186 Y→F: Same affinity for dTDP-glucose and NADPH compared to the wild-type. Small reduction of the catalytic efficiency resulting from the conformational flexibility of the nicotinamide ring.
7d5nB Crystal structure of inositol dehydrogenase homolog complexed with nadh and myo-inositol from azotobacter vinelandii
27% identity, 29% coverage: 54:195/485 of query aligns to 16:168/389 of 7d5nB
- binding 1,2,3,4,5,6-hexahydroxy-cyclohexane: K114 (= K141), Y143 (≠ G170)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G17 (= G55), G19 (≠ K57), S22 (= S60), Q23 (≠ D61), I24 (≠ L62), D46 (= D78), I47 (≠ V79), T91 (= T118), P92 (= P119), N93 (≠ D120), H96 (= H123), E113 (≠ Q140), K114 (= K141)
Sites not aligning to the query:
- binding 1,2,3,4,5,6-hexahydroxy-cyclohexane: 190, 204, 208
- binding 1,4-dihydronicotinamide adenine dinucleotide: 189, 190, 208, 332
7d5mA Crystal structure of inositol dehydrogenase homolog complexed with NAD+ from azotobacter vinelandii
27% identity, 29% coverage: 54:195/485 of query aligns to 17:169/389 of 7d5mA
- binding nicotinamide-adenine-dinucleotide: G18 (= G55), G20 (≠ K57), S23 (= S60), Q24 (≠ D61), I25 (≠ L62), D47 (= D78), I48 (≠ V79), T92 (= T118), P93 (= P119), N94 (≠ D120), H97 (= H123), E114 (≠ Q140), K115 (= K141)
Sites not aligning to the query:
7d5nA Crystal structure of inositol dehydrogenase homolog complexed with nadh and myo-inositol from azotobacter vinelandii
27% identity, 29% coverage: 54:195/485 of query aligns to 16:168/379 of 7d5nA
- binding 1,4-dihydronicotinamide adenine dinucleotide: G17 (= G55), G19 (≠ K57), S22 (= S60), Q23 (≠ D61), I24 (≠ L62), D46 (= D78), I47 (≠ V79), T91 (= T118), P92 (= P119), N93 (≠ D120), H96 (= H123), E113 (≠ Q140), K114 (= K141)
Sites not aligning to the query:
Query Sequence
>CA265_RS15365 FitnessBrowser__Pedo557:CA265_RS15365
MKTEQENKNTSNRRDFIKTTAIAAAAFMIVPRHVLGGPGYLAPSDRLLVAGIGVGGKGQS
DLNMFYKSGKADIAFLCDVDDRRAANSVKAFPKAKYYKDWREMLDKEHKNFDAVSVSTPD
HNHAIQALAAMQLGKHVYVQKPLTHDIYEARILTAAAKKYKVVTQMGNQGASNDGPRQMK
EWYEAGLIGDVHTVYAWTDRPVWPQGIPRPTKKAEIPAELDWNLWLGTAPEKDFIDKLVP
FNWRGWWDYGTGALGDMGCHLIEAPFSVLNLKYAKEVEASVGSVYVDEFKRGYFPESCPP
SSHVTLKFPKTNKTKGDVTLHWMDGGIQPERPEELEANETFGDGGNGTLFIGTKGKMMSE
TYSANPKLLPLSKNKDIKVAPKYTRVPDGANGHYKQWVEAAIAGYGKQEVSSPFEIAGPL
TEALLMANLAIRSFDIQKTVNGKTTYPGRYTKMLWDNDNMKVTNFDEANQFVKREYRKGW
NNLTL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory