SitesBLAST
Comparing CA265_RS15395 CA265_RS15395 aspartate-semialdehyde dehydrogenase to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q04797 Aspartate-semialdehyde dehydrogenase; ASA dehydrogenase; ASADH; Aspartate-beta-semialdehyde dehydrogenase; EC 1.2.1.11 from Bacillus subtilis (strain 168) (see paper)
47% identity, 100% coverage: 1:329/329 of query aligns to 5:346/346 of Q04797
- S98 (= S94) modified: Phosphoserine
- Y146 (= Y142) modified: Phosphotyrosine
4r5hA Crystal structure of sp-aspartate-semialdehyde-dehydrogenase with nicotinamide-adenine-dinucleotide-phosphate and 3-carboxy-propenyl- phthalic acid (see paper)
48% identity, 99% coverage: 3:329/329 of query aligns to 4:346/359 of 4r5hA
- binding 3-[(1E)-3-carboxyprop-1-en-1-yl]benzene-1,2-dicarboxylic acid: S73 (≠ G72), T94 (≠ S93), S95 (= S94), R98 (= R97), N126 (= N125), C127 (= C126), Q154 (= Q153), G158 (= G157), K222 (= K205), R244 (= R227), H251 (= H234)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G7), T10 (= T9), G11 (= G10), A12 (≠ L11), V13 (= V12), A35 (= A34), S36 (= S35), R38 (≠ K37), S39 (= S38), T56 (≠ M55), S70 (= S69), A71 (= A70), G72 (= G71), T75 (= T74), N93 (= N92), T94 (≠ S93), P125 (= P124), N126 (= N125), C127 (= C126), G160 (= G159), M161 (≠ V160), G328 (= G311)
4r4jA Crystal structure of complex sp_asadh with 3-carboxypropyl-phthalic acid and nicotinamide adenine dinucleotide phosphate (see paper)
48% identity, 99% coverage: 3:329/329 of query aligns to 4:346/359 of 4r4jA
- binding 3-(3-carboxypropyl)benzene-1,2-dicarboxylic acid: T94 (≠ S93), S95 (= S94), R98 (= R97), N126 (= N125), C127 (= C126), Q154 (= Q153), G158 (= G157), E219 (= E202), K222 (= K205), R244 (= R227), H251 (= H234)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G7), T10 (= T9), G11 (= G10), A12 (≠ L11), V13 (= V12), A35 (= A34), S36 (= S35), R38 (≠ K37), S39 (= S38), T56 (≠ M55), S70 (= S69), A71 (= A70), G72 (= G71), T75 (= T74), N93 (= N92), T94 (≠ S93), N126 (= N125), C127 (= C126), G160 (= G159), M161 (≠ V160), G328 (= G311)
3pyxB Crystals structure of aspartate beta-semialdehyde dehydrogenase complex with NADP and 2-aminoterephthalate (see paper)
48% identity, 99% coverage: 3:329/329 of query aligns to 4:346/359 of 3pyxB
- binding 2-aminobenzene-1,4-dicarboxylic acid: R98 (= R97), G158 (= G157), E219 (= E202), K222 (= K205), R244 (= R227)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G7), T10 (= T9), G11 (= G10), A12 (≠ L11), V13 (= V12), A35 (= A34), S36 (= S35), R38 (≠ K37), S39 (= S38), T56 (≠ M55), S70 (= S69), A71 (= A70), G72 (= G71), T75 (= T74), C127 (= C126), S157 (≠ T156), G158 (= G157), G160 (= G159), M161 (≠ V160), N324 (= N307), L325 (= L308)
3q11A Crystals structure of aspartate beta-semialdehyde dehydrogenase from streptococcus pneumoniae with NADP and aspartyl beta- difluorophosphonate (see paper)
48% identity, 99% coverage: 3:329/329 of query aligns to 4:346/358 of 3q11A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G7), T10 (= T9), G11 (= G10), A35 (= A34), S36 (= S35), R38 (≠ K37), S39 (= S38), T56 (≠ M55), A71 (= A70), T75 (= T74), G160 (= G159), M161 (≠ V160), G162 (≠ K161)
- binding 5,5-difluoro-4-oxo-5-phosphono-D-norvaline: R98 (= R97), N126 (= N125), C127 (= C126), Q154 (= Q153), G158 (= G157), E219 (= E202), K222 (= K205), R244 (= R227)
4r51A Crystal complex structure of sp-aspartate-semialdehyde-dehydrogenase with nicotinamide adenine dinucleotide phosphate and phthalic acid (see paper)
48% identity, 99% coverage: 3:329/329 of query aligns to 4:346/360 of 4r51A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G7), T10 (= T9), G11 (= G10), A12 (≠ L11), V13 (= V12), A35 (= A34), S36 (= S35), S39 (= S38), T56 (≠ M55), S70 (= S69), A71 (= A70), G72 (= G71), N93 (= N92), T94 (≠ S93), N126 (= N125), C127 (= C126), G160 (= G159), M161 (≠ V160), G328 (= G311)
- binding phthalic acid: S73 (≠ G72), T94 (≠ S93), S95 (= S94), R98 (= R97), N126 (= N125), K222 (= K205)
3pylC Crystal structure of aspartate beta-semialdehide dehydrogenase from streptococcus pneumoniae with d-2,3-diaminopropionate (see paper)
48% identity, 99% coverage: 3:329/329 of query aligns to 4:346/361 of 3pylC
4r54A Complex crystal structure of sp-aspartate-semialdehyde-dehydrogenase with 3-carboxy-ethyl-phthalic acid (see paper)
48% identity, 99% coverage: 3:329/329 of query aligns to 4:346/357 of 4r54A
- binding 3-(2-carboxyethyl)benzene-1,2-dicarboxylic acid: G72 (= G71), S73 (≠ G72), T94 (≠ S93), S95 (= S94), R98 (= R97), K222 (= K205)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G7), T10 (= T9), G11 (= G10), A12 (≠ L11), V13 (= V12), A35 (= A34), S36 (= S35), R38 (≠ K37), S39 (= S38), T56 (≠ M55), S70 (= S69), A71 (= A70), G72 (= G71), T75 (= T74), N93 (= N92), T94 (≠ S93), N126 (= N125), C127 (= C126), G160 (= G159), G328 (= G311)
4r41A Complex crystal structure of 4-nitro-2-phosphono-benzoic acid with sp- aspartate-semialdehyde dehydrogenase and nicotinamide-dinucleotide (see paper)
48% identity, 99% coverage: 3:329/329 of query aligns to 4:346/357 of 4r41A
- binding 4-nitro-2-phosphonobenzoic acid: S70 (= S69), G72 (= G71), S73 (≠ G72), N93 (= N92), T94 (≠ S93), S95 (= S94), R98 (= R97), K222 (= K205)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G7), T10 (= T9), G11 (= G10), A12 (≠ L11), A35 (= A34), S36 (= S35), R38 (≠ K37), S39 (= S38), T56 (≠ M55), A71 (= A70), G160 (= G159), M161 (≠ V160), G162 (≠ K161)
4r3nA Crystal structure of the ternary complex of sp-asadh with NADP and 1, 2,3-benzenetricarboxylic acid (see paper)
48% identity, 99% coverage: 3:329/329 of query aligns to 4:346/357 of 4r3nA
- active site: C127 (= C126), Q154 (= Q153), R244 (= R227), H251 (= H234)
- binding benzene-1,2,3-tricarboxylic acid: S73 (≠ G72), T94 (≠ S93), S95 (= S94), R98 (= R97), N126 (= N125), K222 (= K205)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G7), T10 (= T9), G11 (= G10), A12 (≠ L11), V13 (= V12), A35 (= A34), S36 (= S35), S39 (= S38), T56 (≠ M55), S70 (= S69), A71 (= A70), G72 (= G71), N93 (= N92), T94 (≠ S93), N126 (= N125), C127 (= C126), G160 (= G159), M161 (≠ V160), G328 (= G311)
3q1lA Crystals structure of aspartate beta-semialdehyde dehydrogenase from streptococcus pneumoniae with cysteamine bound covalently to cys 128 (see paper)
48% identity, 99% coverage: 3:329/329 of query aligns to 4:346/357 of 3q1lA
3pwsA Crystal structure of aspartate beta-semialdehide dehydrogenase from streptococcus pneumoniae with 2',5'-adenosine diphosphate and d-2- aminoadipate (see paper)
48% identity, 99% coverage: 3:329/329 of query aligns to 4:346/357 of 3pwsA
- binding (2R)-2-aminohexanedioic acid: R98 (= R97), N126 (= N125), G158 (= G157), I208 (= I191), E219 (= E202), K222 (= K205), R244 (= R227)
- binding adenosine-2'-5'-diphosphate: G8 (= G7), T10 (= T9), G11 (= G10), A12 (≠ L11), A35 (= A34), S36 (= S35), R38 (≠ K37), S39 (= S38), T56 (≠ M55), A71 (= A70), T75 (= T74), G160 (= G159), M161 (≠ V160)
3pwkA Crystal structure of aspartate beta-semialdehide dehydrogenase from streptococcus pneumoniae with 2',5'-adenosine diphosphate and d-2- aminoadipate (see paper)
48% identity, 99% coverage: 3:329/329 of query aligns to 4:346/357 of 3pwkA
- binding 5'-o-monophosphoryladenylyl(2'->5')adenylyl(2'->5')adenosine: G8 (= G7), T10 (= T9), G11 (= G10), A12 (≠ L11), A35 (= A34), S36 (= S35), R38 (≠ K37), S39 (= S38), T56 (≠ M55), A71 (= A70), T75 (= T74), G160 (= G159)
- binding trans-cyclohexane-1,4-dicarboxylic acid: R98 (= R97), N126 (= N125), G158 (= G157), A159 (≠ T158), E219 (= E202), K222 (= K205), R244 (= R227)
2gz3A Structure of aspartate semialdehyde dehydrogenase (asadh) from streptococcus pneumoniae complexed with NADP and aspartate- semialdehyde (see paper)
48% identity, 99% coverage: 3:329/329 of query aligns to 4:346/357 of 2gz3A
- active site: C127 (= C126), Q154 (= Q153), R244 (= R227), H251 (= H234)
- binding (2r)-2-amino-4-oxobutanoic acid: C127 (= C126), Q154 (= Q153), G158 (= G157), E219 (= E202), R244 (= R227), H251 (= H234)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G7), T10 (= T9), G11 (= G10), A12 (≠ L11), V13 (= V12), A35 (= A34), S36 (= S35), R38 (≠ K37), S39 (= S38), T56 (≠ M55), S70 (= S69), A71 (= A70), G72 (= G71), T75 (= T74), N93 (= N92), G158 (= G157), G160 (= G159), M161 (≠ V160), N324 (= N307), A329 (= A312)
2gz2A Structure of aspartate semialdehyde dehydrogenase (asadh) from streptococcus pneumoniae complexed with 2',5'-adp (see paper)
48% identity, 99% coverage: 3:329/329 of query aligns to 4:346/357 of 2gz2A
- active site: C127 (= C126), Q154 (= Q153), R244 (= R227), H251 (= H234)
- binding adenosine-2'-5'-diphosphate: G8 (= G7), T10 (= T9), G11 (= G10), A35 (= A34), S36 (= S35), R38 (≠ K37), S39 (= S38), T56 (≠ M55), A71 (= A70), T75 (= T74)
2gz1A Structure of aspartate semialdehyde dehydrogenase (asadh) from streptococcus pneumoniae complexed with NADP (see paper)
48% identity, 99% coverage: 3:329/329 of query aligns to 4:346/357 of 2gz1A
- active site: C127 (= C126), Q154 (= Q153), R244 (= R227), H251 (= H234)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G7), T10 (= T9), G11 (= G10), A12 (≠ L11), V13 (= V12), A35 (= A34), S36 (= S35), R38 (≠ K37), S39 (= S38), T56 (≠ M55), S70 (= S69), A71 (= A70), G72 (= G71), T75 (= T74), N93 (= N92), S157 (≠ T156), G158 (= G157), G160 (= G159), M161 (≠ V160), N324 (= N307), L325 (= L308)
2r00C Crystal structure of aspartate semialdehyde dehydrogenase ii complexed with asa from vibrio cholerae (see paper)
48% identity, 99% coverage: 1:325/329 of query aligns to 4:333/336 of 2r00C
P23247 Aspartate-semialdehyde dehydrogenase 2; ASA dehydrogenase 2; ASADH 2; Aspartate-beta-semialdehyde dehydrogenase 2; EC 1.2.1.11 from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) (see paper)
48% identity, 99% coverage: 1:325/329 of query aligns to 5:334/337 of P23247
- C132 (= C126) active site, Acyl-thioester intermediate
3tz6A Crystal structure of aspartate semialdehyde dehydrogenase complexed with inhibitor smcs (cys) and phosphate from mycobacterium tuberculosis h37rv (see paper)
41% identity, 98% coverage: 1:323/329 of query aligns to 2:340/342 of 3tz6A
- active site: C129 (= C126), Q156 (= Q153), R248 (= R227), H255 (= H234)
- binding cysteine: C129 (= C126), Q156 (= Q153), G160 (= G157), E223 (= E202), R248 (= R227), H255 (= H234)
- binding glycerol: S108 (≠ P107), G187 (vs. gap), F192 (vs. gap), P201 (≠ E182), Q225 (≠ M204), R228 (≠ V207), F229 (≠ K208), Q335 (= Q318), E338 (= E321), L339 (≠ Y322)
- binding sulfate ion: R98 (= R97), H117 (= H112), R119 (≠ L114), N128 (= N125), C129 (= C126), K226 (= K205), E270 (≠ A249), R273 (= R252)
Q57658 Aspartate-semialdehyde dehydrogenase; ASA dehydrogenase; ASADH; Aspartate-beta-semialdehyde dehydrogenase; EC 1.2.1.11 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
28% identity, 99% coverage: 1:326/329 of query aligns to 9:352/354 of Q57658
Query Sequence
>CA265_RS15395 CA265_RS15395 aspartate-semialdehyde dehydrogenase
MKVAVVGATGLVGTVMLKVLEERNFPLTELIPVASEKSVGKEITFKGKKFPIVSMDTAIS
MKPDIALFSAGGNTSLEHAPRFKEAGTTVIDNSSAWRMDPAIKLIVPEVNAHELSIDNKI
IANPNCSTIQMVVVLKPLHDKYKIKRVVVSTYQSVTGTGVKAVEQLMNERKGVDGPKAYP
YEIDLNVLPHIDVFMENGYTKEEMKMVKETNKIMSDDSIKVTATTVRIPVMGGHSESVNI
EFENDFDLAEVRSILEKSPGIIVVDDVANLKYPMPKDAHEKDEVFVGRIRRDESAPKALN
LWIVADNLRKGAATNAVQIAEYLIQKELV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory