Comparing CA265_RS15455 FitnessBrowser__Pedo557:CA265_RS15455 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
Q837U5 Putative agmatine deiminase; Agmatine iminohydrolase; EC 3.5.3.12 from Enterococcus faecalis (strain ATCC 700802 / V583) (see paper)
36% identity, 95% coverage: 18:356/358 of query aligns to 9:363/365 of Q837U5
3h7cX Crystal structure of arabidopsis thaliana agmatine deiminase from cell free expression
34% identity, 95% coverage: 18:357/358 of query aligns to 7:366/369 of 3h7cX
6b2wA C. Jejuni c315s agmatine deiminase with substrate bound (see paper)
36% identity, 93% coverage: 22:353/358 of query aligns to 6:326/333 of 6b2wA
G7JT50 Agmatine deiminase; Agmatine iminohydrolase; MtAIH; EC 3.5.3.12 from Medicago truncatula (Barrel medic) (Medicago tribuloides) (see paper)
33% identity, 96% coverage: 14:358/358 of query aligns to 3:374/374 of G7JT50
Q8GWW7 Agmatine deiminase; Agmatine iminohydrolase; Protein EMBRYO DEFECTIVE 1873; EC 3.5.3.12 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
34% identity, 95% coverage: 18:357/358 of query aligns to 7:373/383 of Q8GWW7
6nicD Crystal structure of medicago truncatula agmatine iminohydrolase (deiminase) in complex with 6-aminohexanamide (see paper)
34% identity, 94% coverage: 22:358/358 of query aligns to 1:360/360 of 6nicD
>CA265_RS15455 FitnessBrowser__Pedo557:CA265_RS15455
MSNFPPRKDLNINQFDYSPKQQGYAFPAEWAKHEATWLSWPHKEASWPDKIETIYEPYCQ
FIKAVAEGEKVRINVKDEEMKAFAVSELTKVDADLSQIEFYFNETNDAWCRDHGPAFLLK
GNEKAVVDWGYNAWGGKYPPFDLDDVVPTKIANHFKLPLFTPDIVMEGGSVEFNGAGTVL
TTTACLLNENRNPHLTKAQIEQYLLEYYGQEQVLWLGDGIVGDDTDGHIDDITRFVNEDT
VLTVVESNPLDENYLLLQENLAALKAMKLKDGRALNIVELPMPSPVIHEDTRLPASYANF
YIANAAVIVPVFDDVNDQKALAIIQGCFPDRKVIGINSVDIIWGLGSFHCLSQQEPAV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory