Comparing CA265_RS15465 FitnessBrowser__Pedo557:CA265_RS15465 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5h8iC Crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) in complex with n-(dihydroxymethyl)putrescine (see paper)
44% identity, 96% coverage: 2:281/291 of query aligns to 7:289/301 of 5h8iC
5h8jB Crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) in complex with cadaverine (see paper)
44% identity, 96% coverage: 2:281/291 of query aligns to 3:285/297 of 5h8jB
5h8lB Crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) c158s mutant in complex with putrescine (see paper)
44% identity, 96% coverage: 2:281/291 of query aligns to 4:286/298 of 5h8lB
3klcB Crystal structure of hyperthermophilic nitrilase (see paper)
36% identity, 97% coverage: 4:285/291 of query aligns to 1:252/261 of 3klcB
Sites not aligning to the query:
3klcA Crystal structure of hyperthermophilic nitrilase (see paper)
36% identity, 97% coverage: 4:285/291 of query aligns to 1:252/261 of 3klcA
Q9UYV8 Nitrilase; PaNit; EC 3.5.5.1 from Pyrococcus abyssi (strain GE5 / Orsay) (see paper)
35% identity, 97% coverage: 4:285/291 of query aligns to 2:253/262 of Q9UYV8
6ypaB The c146a variant of an amidase from pyrococcus horikoshii with bound glutaramide
37% identity, 88% coverage: 4:260/291 of query aligns to 9:245/269 of 6ypaB
7ovgA The c146a variant of an amidase from pyrococcus horikoshii with bound acetamide (see paper)
37% identity, 88% coverage: 4:260/291 of query aligns to 3:239/263 of 7ovgA
Q9NQR4 Omega-amidase NIT2; Nitrilase homolog 2; EC 3.5.1.3 from Homo sapiens (Human) (see 2 papers)
32% identity, 96% coverage: 1:280/291 of query aligns to 1:269/276 of Q9NQR4
Q9UBR1 Beta-ureidopropionase; BUP-1; Beta-alanine synthase; N-carbamoyl-beta-alanine amidohydrolase; EC 3.5.1.6 from Homo sapiens (Human) (see 4 papers)
30% identity, 89% coverage: 23:280/291 of query aligns to 101:365/384 of Q9UBR1
Sites not aligning to the query:
Q964D8 Beta-ureidopropionase; Beta-alanine synthase; N-carbamoyl-beta-alanine amidohydrolase; EC 3.5.1.6 from Dictyostelium discoideum (Social amoeba)
29% identity, 99% coverage: 4:291/291 of query aligns to 75:379/391 of Q964D8
Sites not aligning to the query:
Q44185 N-carbamoyl-D-amino acid hydrolase; D-N-alpha-carbamilase; EC 3.5.1.77 from Rhizobium radiobacter (Agrobacterium tumefaciens) (Agrobacterium radiobacter) (see paper)
28% identity, 87% coverage: 15:268/291 of query aligns to 19:285/304 of Q44185
8hpcC Crystal structure of c171a mutant of n-carbamyl-d-amino acid amidohydrolase complexed with n-carbamyl-d-hydroxyphenylglycine
27% identity, 91% coverage: 15:280/291 of query aligns to 18:297/303 of 8hpcC
1uf8A Crystal structure of c171a/v236a mutant of n-carbamyl-d-amino acid amidohydrolase complexed with n-carbamyl-d-phenylalanine
27% identity, 91% coverage: 15:280/291 of query aligns to 18:297/303 of 1uf8A
1uf7A Crystal structure of c171a/v236a mutant of n-carbamyl-d-amino acid amidohydrolase complexed with n-carbamyl-d-valine
27% identity, 91% coverage: 15:280/291 of query aligns to 18:297/303 of 1uf7A
1uf5A Crystal structure of c171a/v236a mutant of n-carbamyl-d-amino acid amidohydrolase complexed with n-carbamyl-d-methionine
27% identity, 91% coverage: 15:280/291 of query aligns to 18:297/303 of 1uf5A
4iztA The e41q mutant of the amidase from nesterenkonia sp. An1 showing covalent addition of the acetamide moiety of fluoroacetamide at the active site cysteine
24% identity, 96% coverage: 2:281/291 of query aligns to 8:260/263 of 4iztA
5nybA A c145a mutant of nesterenkonia an1 amidase bound to adipamide
24% identity, 96% coverage: 2:281/291 of query aligns to 7:259/262 of 5nybA
5ny7A A c145a mutant of nesterenkonia an1 amidase bound to nicotinamide
24% identity, 96% coverage: 2:281/291 of query aligns to 7:259/262 of 5ny7A
Sites not aligning to the query:
4izuA The e41q mutant of the amidase from nesterenkonia sp. An1 showing the result of michael addition of acrylamide at the active site cysteine
25% identity, 82% coverage: 4:242/291 of query aligns to 2:223/254 of 4izuA
>CA265_RS15465 FitnessBrowser__Pedo557:CA265_RS15465
MKKVKVGLVQMSCTKVKQENLDKAIAKVREAAAKGAQIVCLQELFTSLYFCDVEDYDNFD
LAEAIPGPSTDALQVVAKELGVVIIASLFEKRAEGLYHNTTAVLDADGSYLGKYRKMHIP
DDPAFYEKFYFTPGDLGYKVFETKFAKIGILICWDQWYPEASRITALMGADIMFYPTAIG
WATDQDEETNQDQYNAWQTIQRSHAVANGVPVVSVNRVGFEQDGAMKFWGGSFATNGQGK
LLYLASHDLEETEVVELDLSESDFFRKHWPFLRDRRIDSYQPITKRYIDGD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory