Comparing CA265_RS15560 FitnessBrowser__Pedo557:CA265_RS15560 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6zl4A The structure of glutamate transporter homologue glttk in complex with the photo switchable compound (cis) (see paper)
30% identity, 94% coverage: 14:415/428 of query aligns to 3:423/424 of 6zl4A
6zgbA Glutamate transporter homologue glttk in complex with a photo cage compound (see paper)
30% identity, 94% coverage: 14:415/428 of query aligns to 4:424/425 of 6zgbA
5e9sA Crystal structure of substrate-bound glutamate transporter homologue glttk (see paper)
30% identity, 94% coverage: 14:415/428 of query aligns to 6:426/427 of 5e9sA
6xwnB Structure of glutamate transporter homologue glttk in the presence of tboa inhibitor (see paper)
30% identity, 94% coverage: 14:415/428 of query aligns to 6:426/426 of 6xwnB
6r7rA Crystal structure of the glutamate transporter homologue glttk in complex with d-aspartate (see paper)
29% identity, 93% coverage: 16:415/428 of query aligns to 1:415/416 of 6r7rA
O59010 Glutamate transporter homolog; Glt(Ph); Sodium-aspartate symporter Glt(Ph); Sodium-dependent aspartate transporter from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 3 papers)
28% identity, 94% coverage: 9:410/428 of query aligns to 11:421/425 of O59010
6x14A Inward-facing state of the glutamate transporter homologue gltph in complex with tfb-tboa (see paper)
28% identity, 93% coverage: 9:405/428 of query aligns to 8:413/413 of 6x14A
Sites not aligning to the query:
6x15A Inward-facing state of the glutamate transporter homologue gltph in complex with l-aspartate and sodium ions (see paper)
28% identity, 93% coverage: 9:405/428 of query aligns to 11:416/419 of 6x15A
Sites not aligning to the query:
2nwwA Crystal structure of gltph in complex with tboa (see paper)
28% identity, 93% coverage: 9:405/428 of query aligns to 2:407/407 of 2nwwA
6bauA Crystal structure of gltph r397c in complex with l-cysteine (see paper)
28% identity, 93% coverage: 9:405/428 of query aligns to 3:408/408 of 6bauA
6bavA Crystal structure of gltph r397c in complex with s-benzyl-l-cysteine (see paper)
28% identity, 93% coverage: 9:405/428 of query aligns to 3:408/409 of 6bavA
6bmiA Crystal structure of gltph r397c in complex with l-serine (see paper)
26% identity, 93% coverage: 9:405/428 of query aligns to 3:396/396 of 6bmiA
7awmA Structure of the thermostabilized eaat1 cryst mutant in complex with l-asp, three sodium ions and the allosteric inhibitor ucph101 (see paper)
30% identity, 86% coverage: 46:412/428 of query aligns to 60:410/412 of 7awmA
5mjuA Structure of the thermostabilized eaat1 cryst mutant in complex with the competititve inhibitor tfb-tboa and the allosteric inhibitor ucph101 (see paper)
29% identity, 86% coverage: 46:412/428 of query aligns to 52:396/397 of 5mjuA
Q10901 Excitatory amino acid transporter; Sodium-dependent glutamate/ aspartate transporter from Caenorhabditis elegans (see paper)
25% identity, 87% coverage: 46:416/428 of query aligns to 59:472/503 of Q10901
8cv2A Human excitatory amino acid transporter 3 (eaat3) in an outward facing sodium-bound state (see paper)
26% identity, 82% coverage: 61:411/428 of query aligns to 61:429/433 of 8cv2A
O35874 Neutral amino acid transporter A; Alanine/serine/cysteine/threonine transporter 1; ASCT-1; Solute carrier family 1 member 4 from Mus musculus (Mouse) (see 2 papers)
27% identity, 95% coverage: 22:427/428 of query aligns to 52:504/532 of O35874
7xr6A Structure of human excitatory amino acid transporter 2 (eaat2) in complex with way-213613 (see paper)
27% identity, 85% coverage: 46:409/428 of query aligns to 50:419/424 of 7xr6A
Sites not aligning to the query:
8cuaA Human excitatory amino acid transporter 3 (eaat3) with bound potassium in an intermediate outward facing state (see paper)
26% identity, 82% coverage: 61:411/428 of query aligns to 61:411/416 of 8cuaA
7xr4A Structure of human excitatory amino acid transporter 2 (eaat2) in complex with glutamate (see paper)
27% identity, 85% coverage: 46:409/428 of query aligns to 49:420/425 of 7xr4A
>CA265_RS15560 FitnessBrowser__Pedo557:CA265_RS15560
MTVTEFIKKVFSNLTFQVLLAIIIGIYVGAYFPGFAPTAKLISQGFINLISMLIAPIIFF
TIVLGIAHMGDMKKVGRVGGKALLYFEIVSTVAIAIGLLVANVLKPGAGMIAKAGDATKI
AGYAEQAKDMNWAEFFLHIIPHNIIASFAEGNILQILLFAILFGYGLNKLGGEGTTVLNA
FDKISKVLFKIMKLIMRLAPIGAFGGMAFSIGTHGLESIVGMAKLMGSVYLTCFLFIFVI
LNGICRYYNFSLWAYLKYIRQEILIVLGTSSSESALPSMMQKMEAIGCDKSVVGLVIPTG
YSFNLDGTAIYLAMAVIFLCQVFHVDLTLGQQITVLGVLMITSKGAAGVTGSGFIVLVST
LTALKIMPIEHISILIGVDRFMSEARAITNVIGNGVATIVIAKSEKQFDEQKYLKAIQPA
MIEKAEEV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory