SitesBLAST
Comparing CA265_RS15670 CA265_RS15670 4-hydroxy-tetrahydrodipicolinate reductase to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9X1K8 4-hydroxy-tetrahydrodipicolinate reductase; HTPA reductase; EC 1.17.1.8 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
34% identity, 99% coverage: 1:242/244 of query aligns to 1:211/216 of Q9X1K8
1vm6B Crystal structure of dihydrodipicolinate reductase (tm1520) from thermotoga maritima at 2.27 a resolution
34% identity, 99% coverage: 1:242/244 of query aligns to 6:216/218 of 1vm6B
- active site: H132 (= H135), K136 (= K139)
- binding nicotinamide-adenine-dinucleotide: G12 (= G7), S14 (vs. gap), G15 (= G9), R16 (≠ K10), M17 (= M11), D37 (≠ T31), V38 (≠ I32), F53 (= F52), S54 (= S53), S55 (≠ T54), E57 (≠ D56), A58 (≠ S57), G76 (= G75), T78 (= T77), Y101 (= Y99), N102 (= N102), F103 (= F103), F192 (= F219)
4ywjA Crystal structure of 4-hydroxy-tetrahydrodipicolinate reductase (htpa reductase) from pseudomonas aeruginosa
35% identity, 81% coverage: 47:243/244 of query aligns to 71:265/268 of 4ywjA
- active site: H156 (= H135), K160 (= K139)
- binding nicotinamide-adenine-dinucleotide: F76 (= F52), T77 (≠ S53), V81 (≠ S57), G99 (= G75), T101 (= T77), A124 (≠ S101), N125 (= N102), F126 (= F103), R237 (= R216), F240 (= F219)
Sites not aligning to the query:
5temA Structure of 4-hydroxy-tetrahydrodipicolinate reductase from vibrio vulnificus with 2,6 pyridine dicarboxylic and nadh (see paper)
35% identity, 85% coverage: 36:243/244 of query aligns to 60:264/266 of 5temA
- active site: H155 (= H135), K159 (= K139)
- binding nicotinamide-adenine-dinucleotide: F75 (= F52), T76 (≠ S53), S80 (= S57), G98 (= G75), T100 (= T77), P123 (≠ S101), N124 (= N102), Y125 (≠ F103), F239 (= F219)
- binding pyridine-2,6-dicarboxylic acid: T100 (= T77), P123 (≠ S101), H156 (= H136), K159 (= K139), S164 (= S144), G165 (= G145), T166 (= T146)
Sites not aligning to the query:
5tejB Structure of 4-hydroxy-tetrahydrodipicolinate reductase from vibrio vulnificus with 2,5 furan dicarboxylic and nadh (see paper)
35% identity, 85% coverage: 36:243/244 of query aligns to 60:264/269 of 5tejB
- active site: H155 (= H135), K159 (= K139)
- binding 2,5 Furan Dicarboxylic Acid: T100 (= T77), H156 (= H136), K159 (= K139), S164 (= S144), G165 (= G145), T166 (= T146)
- binding nicotinamide-adenine-dinucleotide: F75 (= F52), T76 (≠ S53), S80 (= S57), G98 (= G75), T100 (= T77), P123 (≠ S101), N124 (= N102), Y125 (≠ F103), F239 (= F219)
Sites not aligning to the query:
5tejA Structure of 4-hydroxy-tetrahydrodipicolinate reductase from vibrio vulnificus with 2,5 furan dicarboxylic and nadh (see paper)
35% identity, 85% coverage: 36:243/244 of query aligns to 60:264/269 of 5tejA
Sites not aligning to the query:
1drvA Escherichia coli dhpr/acnadh complex (see paper)
30% identity, 88% coverage: 30:244/244 of query aligns to 57:266/270 of 1drvA
Sites not aligning to the query:
1druA Escherichia coli dhpr/nadh complex (see paper)
30% identity, 88% coverage: 30:244/244 of query aligns to 57:266/270 of 1druA
- active site: H156 (= H135), K160 (= K139)
- binding nicotinamide-adenine-dinucleotide: F76 (= F52), T77 (≠ S53), R78 (≠ T54), G81 (≠ S57), G99 (= G75), T100 (= T76), T101 (= T77), A124 (≠ S101), N125 (= N102), F126 (= F103), F240 (= F219)
Sites not aligning to the query:
1arzA Escherichia coli dihydrodipicolinate reductase in complex with nadh and 2,6 pyridine dicarboxylate (see paper)
30% identity, 88% coverage: 30:244/244 of query aligns to 57:266/270 of 1arzA
1arzB Escherichia coli dihydrodipicolinate reductase in complex with nadh and 2,6 pyridine dicarboxylate (see paper)
30% identity, 88% coverage: 30:244/244 of query aligns to 56:265/269 of 1arzB
- active site: H155 (= H135), K159 (= K139)
- binding 1,4-dihydronicotinamide adenine dinucleotide: F75 (= F52), T76 (≠ S53), R77 (≠ T54), G80 (≠ S57), H84 (≠ N61), G98 (= G75), T100 (= T77), A123 (≠ S101), N124 (= N102), F125 (= F103), F239 (= F219)
- binding pyridine-2,6-dicarboxylic acid: T100 (= T77), H156 (= H136), K159 (= K139), S164 (= S144), G165 (= G145), T166 (= T146), F239 (= F219)
Sites not aligning to the query:
P04036 4-hydroxy-tetrahydrodipicolinate reductase; HTPA reductase; EC 1.17.1.8 from Escherichia coli (strain K12) (see 3 papers)
30% identity, 88% coverage: 30:244/244 of query aligns to 60:269/273 of P04036
- TR 80:81 (≠ ST 53:54) binding
- GTT 102:104 (= GTT 75:77) binding ; binding
- AANF 126:129 (≠ GSNF 100:103) binding
- F129 (= F103) binding
- H159 (= H135) mutation H->A,Q: 135 to 200-fold reduction in catalytic activity.
- K163 (= K139) binding ; mutation K->A,C,Q: 625 to 830-fold reduction in catalytic activity.
- R240 (= R216) binding
- F243 (= F219) binding
Sites not aligning to the query:
- 12 binding
- 15:17 binding
- 16:17 binding
- 38 binding
- 39 binding
1drwA Escherichia coli dhpr/nhdh complex (see paper)
30% identity, 88% coverage: 30:244/244 of query aligns to 59:268/272 of 1drwA
- active site: H158 (= H135), K162 (= K139)
- binding nicotinamide purin-6-ol-dinucleotide: F78 (= F52), T79 (≠ S53), R80 (≠ T54), G101 (= G75), T102 (= T76), T103 (= T77), A126 (≠ S101), N127 (= N102), F128 (= F103), F242 (= F219)
Sites not aligning to the query:
1dihA Three-dimensional structure of e. Coli dihydrodipicolinate reductase (see paper)
30% identity, 88% coverage: 30:244/244 of query aligns to 59:268/272 of 1dihA
- active site: H158 (= H135), K162 (= K139)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: F78 (= F52), T79 (≠ S53), R80 (≠ T54), G83 (≠ S57), G101 (= G75), T103 (= T77), N127 (= N102), F128 (= F103), R239 (= R216), F242 (= F219)
Sites not aligning to the query:
5eesA Crystal structure of dapb in complex with NADP+ from corynebacterium glutamicum (see paper)
29% identity, 97% coverage: 1:236/244 of query aligns to 2:237/247 of 5eesA
- active site: H133 (= H135), K137 (= K139)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G7), G11 (= G9), R12 (≠ K10), V13 (≠ M11), G34 (≠ T31), V35 (≠ I32), F53 (= F52), T54 (≠ S53), G76 (= G75), T78 (= T77), P104 (≠ S101), N105 (= N102), F106 (= F103), F220 (= F219)
- binding sulfate ion: H134 (= H136), K137 (= K139), K137 (= K139), G143 (= G145), T144 (= T146)
5eerA Crystal structure of dapb from corynebacterium glutamicum (see paper)
29% identity, 97% coverage: 1:236/244 of query aligns to 2:237/247 of 5eerA
P9WP23 4-hydroxy-tetrahydrodipicolinate reductase; HTPA reductase; EC 1.17.1.8 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
27% identity, 97% coverage: 1:236/244 of query aligns to 1:234/245 of P9WP23
- K9 (vs. gap) mutation to A: Increases the nucleotide specificity from 6:1 for the wild-type enzyme to 34:1, due to a 4-fold decrease in NADPH affinity while the affinity for NADH remains nearly unchanged.
- K11 (= K10) mutation to A: 2.8-fold increase in catalytic activity with NADH as substrate, while the affinity for NADH is essentially unaffected. 70-fold decrease in affinity for NADPH, causing the nucleotide specificity to increase from 6:1 for the wild-type enzyme to 187:1.
- KV 11:12 (≠ KM 10:11) binding ; binding
- D33 (= D33) binding
- GTT 75:77 (= GTT 75:77) binding ; binding
- APNF 102:105 (≠ GSNF 100:103) binding ; binding
- K136 (= K139) binding ; binding
5ugvA Dapb from mycobacterium tuberculosis (see paper)
27% identity, 97% coverage: 1:236/244 of query aligns to 2:235/245 of 5ugvA
5tjzA Structure of 4-hydroxytetrahydrodipicolinate reductase from mycobacterium tuberculosis with NADPH and 2,6 pyridine dicarboxylic acid (see paper)
27% identity, 97% coverage: 1:236/244 of query aligns to 2:235/245 of 5tjzA
- active site: H133 (= H135), K137 (= K139)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G7), G11 (= G9), K12 (= K10), V13 (≠ M11), D34 (= D33), A35 (≠ N34), F53 (= F52), T54 (≠ S53), G76 (= G75), T77 (= T76), T78 (= T77), P104 (≠ S101), N105 (= N102), F106 (= F103), F218 (= F219)
- binding pyridine-2,6-dicarboxylic acid: T78 (= T77), P104 (≠ S101), H134 (= H136), K137 (= K139), S142 (= S144), G143 (= G145), T144 (= T146), A193 (≠ G194)
1p9lA Structure of m. Tuberculosis dihydrodipicolinate reductase in complex with nadh and 2,6 pdc (see paper)
27% identity, 97% coverage: 1:236/244 of query aligns to 1:234/245 of 1p9lA
- active site: H132 (= H135), K136 (= K139)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G7 (= G7), G10 (= G9), K11 (= K10), V12 (≠ M11), D33 (= D33), A34 (≠ N34), F52 (= F52), T53 (≠ S53), V57 (≠ S57), G75 (= G75), T77 (= T77), P103 (≠ S101), N104 (= N102), F105 (= F103), F217 (= F219)
- binding pyridine-2,6-dicarboxylic acid: H133 (= H136), K136 (= K139), S141 (= S144), G142 (= G145), T143 (= T146), A192 (≠ G194)
1c3vA Dihydrodipicolinate reductase from mycobacterium tuberculosis complexed with NADPH and pdc (see paper)
27% identity, 97% coverage: 1:236/244 of query aligns to 1:234/245 of 1c3vA
- active site: H132 (= H135), K136 (= K139)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: K9 (vs. gap), G10 (= G9), K11 (= K10), V12 (≠ M11), D33 (= D33), A34 (≠ N34), F52 (= F52), T53 (≠ S53), V57 (≠ S57), G75 (= G75), T77 (= T77), P103 (≠ S101), N104 (= N102), F217 (= F219)
- binding pyridine-2,6-dicarboxylic acid: T77 (= T77), N104 (= N102), K136 (= K139), S141 (= S144), G142 (= G145), T143 (= T146), A192 (≠ G194)
Query Sequence
>CA265_RS15670 CA265_RS15670 4-hydroxy-tetrahydrodipicolinate reductase
MKLALLGYGKMGQIIEKFAVERGHEIVLKITIDNQEDLTRQNLKSADVAIDFSTPDSVLK
NIDACFDANVPIVVGTTGWYGKLQEVKDDCNNSNNTLLYGSNFSIGVNLFFKLNQTLAKL
MNNYPAYEVQVEEIHHTQKLDAPSGTAITLAEGIVDNLDRKQEWLNEVVGTDVELFPKAE
QLLIESHRIENIPGTHTVIYSSEVDEIEIKHTAHNRAGFALGAVVAAEWLKDKKGFFSIT
DIFE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory