SitesBLAST
Comparing CA265_RS15785 FitnessBrowser__Pedo557:CA265_RS15785 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4whxA X-ray crystal structure of an amino acid aminotransferase from burkholderia pseudomallei bound to the co-factor pyridoxal phosphate
38% identity, 94% coverage: 10:286/296 of query aligns to 9:292/306 of 4whxA
1iyeA Crystal structure of eschelichia coli branched-chain amino acid aminotransferase (see paper)
38% identity, 86% coverage: 10:264/296 of query aligns to 5:267/304 of 1iyeA
- active site: F33 (= F38), G35 (= G40), K156 (= K154), A157 (≠ L155), E190 (= E188), L214 (= L211)
- binding N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)-L-glutamic acid: R56 (= R61), Y92 (= Y97), Y126 (= Y128), K156 (= K154), Y161 (= Y159), E190 (= E188), G193 (= G191), E194 (≠ A192), N195 (= N193), L214 (= L211), G216 (= G213), I217 (= I214), T218 (= T215), G253 (= G250), T254 (= T251), A255 (= A252)
1iydA Crystal structure of eschelichia coli branched-chain amino acid aminotransferase (see paper)
38% identity, 86% coverage: 10:264/296 of query aligns to 5:267/304 of 1iydA
- active site: F33 (= F38), G35 (= G40), K156 (= K154), A157 (≠ L155), E190 (= E188), L214 (= L211)
- binding glutaric acid: Y92 (= Y97), Y126 (= Y128), A255 (= A252)
- binding pyridoxal-5'-phosphate: R56 (= R61), K156 (= K154), Y161 (= Y159), E190 (= E188), G193 (= G191), E194 (≠ A192), L214 (= L211), G216 (= G213), I217 (= I214), T218 (= T215), T254 (= T251)
1i1mA Crystal structure of escherichia coli branched-chain amino acid aminotransferase. (see paper)
38% identity, 86% coverage: 10:264/296 of query aligns to 5:267/304 of 1i1mA
- active site: K156 (= K154)
- binding 4-methyl valeric acid: Y92 (= Y97), K156 (= K154), T254 (= T251), A255 (= A252)
- binding pyridoxal-5'-phosphate: R56 (= R61), K156 (= K154), Y161 (= Y159), E190 (= E188), G193 (= G191), E194 (≠ A192), L214 (= L211), G216 (= G213), I217 (= I214), T218 (= T215), G253 (= G250), T254 (= T251)
1i1lA Crystal structure of eschelichia coli branched-chain amino acid aminotransferase. (see paper)
38% identity, 86% coverage: 10:264/296 of query aligns to 5:267/304 of 1i1lA
- active site: K156 (= K154)
- binding 2-methylleucine: Y92 (= Y97), K156 (= K154), T254 (= T251), A255 (= A252)
- binding pyridoxal-5'-phosphate: R56 (= R61), K156 (= K154), Y161 (= Y159), E190 (= E188), G193 (= G191), G216 (= G213), I217 (= I214), T218 (= T215), T254 (= T251)
6thqB Crystal structure of branched-chain aminotransferase from thermophilic archaea thermoproteus uzoniensis with norvaline
35% identity, 97% coverage: 3:289/296 of query aligns to 2:289/301 of 6thqB
- active site: F37 (= F38), K156 (= K154), E190 (= E188), L214 (= L211)
- binding pyridoxal-5'-phosphate: R60 (= R61), K156 (= K154), Y161 (= Y159), E190 (= E188), N195 (= N193), L214 (= L211), G216 (= G213), I217 (= I214), T218 (= T215), T254 (= T251)
- binding 2-[o-phosphonopyridoxyl]-amino-pentanoic acid: R60 (= R61), Y97 (= Y97), K156 (= K154), Y161 (= Y159), E190 (= E188), G193 (= G191), E194 (≠ A192), N195 (= N193), G216 (= G213), I217 (= I214), T218 (= T215), G253 (= G250), T254 (= T251), A255 (= A252)
2ej0B Crystal structure of t.Th.Hb8 branched-chain amino acid aminotransferase with pyridoxamine 5'-phosphate
35% identity, 96% coverage: 9:291/296 of query aligns to 6:291/305 of 2ej0B
- active site: F35 (= F38), G37 (= G40), K158 (= K154), E192 (= E188), L215 (= L211)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: R58 (= R61), Y163 (= Y159), E192 (= E188), G195 (= G191), E196 (≠ A192), L215 (= L211), G217 (= G213), I218 (= I214), T219 (= T215), G254 (= G250), T255 (= T251)
2ej2A Crystal structure of t.Th.Hb8 branched-chain amino acid aminotransferase complexed with n-(5'-phosphopyridoxyl)-l-glutamate
35% identity, 96% coverage: 9:291/296 of query aligns to 6:280/294 of 2ej2A
- active site: F35 (= F38), G37 (= G40), K147 (= K154), E181 (= E188), L204 (= L211)
- binding 4-[(1,3-dicarboxy-propylamino)-methyl]-3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridinium: R58 (= R61), Y94 (= Y97), Y152 (= Y159), E181 (= E188), G184 (= G191), E185 (≠ A192), L204 (= L211), G206 (= G213), I207 (= I214), T208 (= T215), T244 (= T251), A245 (= A252)
2ej3A Crystal structure of t.Th.Hb8 branched-chain amino acid aminotransferase complexed with gabapentin
35% identity, 96% coverage: 9:291/296 of query aligns to 6:283/297 of 2ej3A
- active site: F35 (= F38), G37 (= G40), K150 (= K154), E184 (= E188), L207 (= L211)
- binding [1-(aminomethyl)cyclohexyl]acetic acid: G187 (= G191), G246 (= G250), T247 (= T251), A248 (= A252)
- binding pyridoxal-5'-phosphate: R58 (= R61), K150 (= K154), Y155 (= Y159), E184 (= E188), G187 (= G191), L207 (= L211), G209 (= G213), I210 (= I214), T211 (= T215), G246 (= G250), T247 (= T251)
2eiyA Crystal structure of t.Th.Hb8 branched-chain amino acid aminotransferase complexed with 4-methylvaleric acid
35% identity, 96% coverage: 9:291/296 of query aligns to 6:283/297 of 2eiyA
- active site: F35 (= F38), G37 (= G40), K150 (= K154), E184 (= E188), L207 (= L211)
- binding 4-methyl valeric acid: F35 (= F38), Y94 (= Y97), T247 (= T251), A248 (= A252)
- binding pyridoxal-5'-phosphate: R58 (= R61), K150 (= K154), Y155 (= Y159), E184 (= E188), G187 (= G191), E188 (≠ A192), L207 (= L211), G209 (= G213), I210 (= I214), T211 (= T215), G246 (= G250), T247 (= T251)
1wrvA Crystal structure of t.Th.Hb8 branched-chain amino acid aminotransferase
35% identity, 96% coverage: 9:291/296 of query aligns to 6:283/297 of 1wrvA
- active site: F35 (= F38), G37 (= G40), K150 (= K154), E184 (= E188), L207 (= L211)
- binding pyridoxal-5'-phosphate: R58 (= R61), K150 (= K154), Y155 (= Y159), E184 (= E188), G187 (= G191), L207 (= L211), G209 (= G213), I210 (= I214), T211 (= T215), T247 (= T251)
5mr0D Thermophilic archaeal branched-chain amino acid transaminases from geoglobus acetivorans and archaeoglobus fulgidus: biochemical and structural characterisation (see paper)
38% identity, 85% coverage: 10:262/296 of query aligns to 4:257/290 of 5mr0D
- active site: F32 (= F38), G34 (= G40), K150 (= K154), E183 (= E188), L206 (= L211)
- binding 3-[o-phosphonopyridoxyl]--amino-benzoic acid: R51 (= R61), G100 (≠ N107), L101 (≠ M108), K150 (= K154), Y154 (= Y159), E183 (= E188), G186 (= G191), D187 (≠ A192), L206 (= L211), I209 (= I214), T210 (= T215), G245 (= G250), T246 (= T251)
5e25A Crystal structure of branched-chain aminotransferase from thermophilic archaea geoglobus acetivorans complexed with alpha-ketoglutarate (see paper)
37% identity, 87% coverage: 6:262/296 of query aligns to 1:258/290 of 5e25A
- active site: F33 (= F38), G35 (= G40), K151 (= K154), E184 (= E188), L207 (= L211)
- binding 2-oxoglutaric acid: Y88 (= Y97), K151 (= K154), T247 (= T251), A248 (= A252)
- binding pyridoxal-5'-phosphate: R52 (= R61), K151 (= K154), Y155 (= Y159), E184 (= E188), G187 (= G191), D188 (≠ A192), L207 (= L211), G209 (= G213), I210 (= I214), T211 (= T215), G246 (= G250), T247 (= T251)
6q8eA Crystal structure of branched-chain amino acid aminotransferase from thermobaculum terrenum in pmp-form (see paper)
36% identity, 83% coverage: 16:262/296 of query aligns to 15:266/307 of 6q8eA
- active site: F34 (= F38), K156 (= K154), E190 (= E188), L214 (= L211)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: R59 (= R61), K156 (= K154), Y161 (= Y159), E190 (= E188), G193 (= G191), S194 (≠ A192), C195 (≠ N193), L214 (= L211), S216 (≠ G213), I217 (= I214), T218 (= T215), G254 (= G250), T255 (= T251)
7neaA Crystal structure of branched-chain amino acid aminotransferase from thermobaculum terrenum (m3 mutant). (see paper)
35% identity, 83% coverage: 16:262/296 of query aligns to 15:266/309 of 7neaA
- active site: F34 (= F38), K156 (= K154), E190 (= E188), L214 (= L211)
- binding pyridoxal-5'-phosphate: R59 (= R61), K156 (= K154), Y161 (= Y159), E190 (= E188), G193 (= G191), S194 (≠ A192), L214 (= L211), S216 (≠ G213), I217 (= I214), T218 (= T215), T255 (= T251)
6h65C Crystal structure of the branched-chain-amino-acid aminotransferase from haliangium ochraceum
27% identity, 86% coverage: 11:264/296 of query aligns to 8:270/308 of 6h65C
- active site: F35 (= F38), K158 (= K154), E192 (= E188), L216 (= L211)
- binding pyridoxal-5'-phosphate: R60 (= R61), K158 (= K154), Y163 (= Y159), E192 (= E188), A196 (= A192), L216 (= L211), S218 (≠ G213), V219 (≠ I214), T220 (= T215), G256 (= G250), T257 (= T251)
6jifB Crystal structures of branched-chain aminotransferase from pseudomonas sp. Uw4 (see paper)
29% identity, 87% coverage: 30:286/296 of query aligns to 45:317/334 of 6jifB
- binding pyridoxal-5'-phosphate: R77 (= R61), R169 (= R143), K179 (= K154), Y184 (= Y159), E215 (= E188), S218 (≠ G191), A219 (= A192), N220 (= N193), L239 (= L211), G241 (= G213), I242 (= I214), T243 (= T215), G279 (= G250), T280 (= T251)
7p3tB Transaminase of gamma-proteobacterium (see paper)
32% identity, 84% coverage: 9:257/296 of query aligns to 5:260/299 of 7p3tB
- binding pyridoxal-5'-phosphate: R53 (= R61), K153 (≠ A153), R157 (≠ Y159), E186 (= E188), S187 (≠ A189), A188 (≠ S190), A189 (≠ G191), S190 (≠ A192), G210 (= G213), I211 (= I214), T212 (= T215), T248 (= T251)
3uyyB Crystal structures of branched-chain aminotransferase from deinococcus radiodurans complexes with alpha-ketoisocaproate and l-glutamate suggest its radio-resistance for catalysis (see paper)
30% identity, 87% coverage: 30:286/296 of query aligns to 47:320/337 of 3uyyB
- active site: K181 (= K154)
- binding pyridoxal-5'-phosphate: R79 (= R61), R171 (= R143), K181 (= K154), Y186 (= Y159), E217 (= E188), G219 (≠ S190), A220 (≠ G191), A221 (= A192), S244 (≠ G213), I245 (= I214), T246 (= T215), G282 (= G250), T283 (= T251)
3uzoA Crystal structures of branched-chain aminotransferase from deinococcus radiodurans complexes with alpha-ketoisocaproate and l-glutamate suggest its radio-resistance for catalysis (see paper)
30% identity, 87% coverage: 30:286/296 of query aligns to 45:318/335 of 3uzoA
- active site: K179 (= K154)
- binding glutamic acid: Y48 (= Y33), F53 (= F38), R122 (= R99), V134 (≠ L110), Y152 (≠ A127), T281 (= T251), A282 (= A252)
- binding pyridoxal-5'-phosphate: R77 (= R61), K179 (= K154), Y184 (= Y159), E215 (= E188), G217 (≠ S190), A218 (≠ G191), A219 (= A192), N220 (= N193), L240 (= L211), S242 (≠ G213), I243 (= I214), T244 (= T215), G280 (= G250), T281 (= T251)
Query Sequence
>CA265_RS15785 FitnessBrowser__Pedo557:CA265_RS15785
MKYYNSNTIIYLDGQFEKAVNSSTDLYGQSLHYGYAAFEGIRAYKTHNGNRIFKAAAHFD
RLERSCQLANIPFPWDKQELIAATYKLLQLNKLKDAYIRPLVFCHPNMKLNEPSGVSILI
CAWEWDAYSGNKLLKLTVSDYERPNPKSIPMEAKLSGNYVNSILATTAANIKGYDEALLL
DMHGFVAEASGANIFLEKDGKLFTPSLGNILPGITRATVKELCTVLDIECIEKKLTIEDL
KNADSAFLCGTATEIAGIASIDDIVYRPIWRESIGYTIQRAYKNLVLEKVNYEVII
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory