Comparing CA265_RS15795 FitnessBrowser__Pedo557:CA265_RS15795 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 12 hits to proteins with known functional sites (download)
Q9LIR4 Dihydroxy-acid dehydratase, chloroplastic; AthDHAD; DAD; EC 4.2.1.9 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
60% identity, 100% coverage: 2:559/560 of query aligns to 51:608/608 of Q9LIR4
8hs0A The mutant structure of dhad v178w
60% identity, 100% coverage: 2:559/560 of query aligns to 13:570/570 of 8hs0A
P9WKJ5 Dihydroxy-acid dehydratase; DAD; EC 4.2.1.9 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
46% identity, 99% coverage: 1:556/560 of query aligns to 14:573/575 of P9WKJ5
6ovtA Crystal structure of ilvd from mycobacterium tuberculosis (see paper)
46% identity, 99% coverage: 1:556/560 of query aligns to 1:560/562 of 6ovtA
B5ZZ34 L-arabinonate dehydratase; ArDHT; D-fuconate dehydratase; Galactonate dehydratase; L-arabonate dehydratase; EC 4.2.1.25; EC 4.2.1.67; EC 4.2.1.6 from Rhizobium leguminosarum bv. trifolii (strain WSM2304) (see 2 papers)
34% identity, 93% coverage: 39:558/560 of query aligns to 47:564/579 of B5ZZ34
5j85A Ser480ala mutant of l-arabinonate dehydratase (see paper)
34% identity, 93% coverage: 39:558/560 of query aligns to 44:561/576 of 5j85A
8ej0A Crystal structure of fe-s cluster-dependent dehydratase from paralcaligenes ureilyticus in complex with mg
34% identity, 93% coverage: 39:558/560 of query aligns to 38:553/568 of 8ej0A
8epzA Crystal structure of fe-s cluster-dependent dehydratase from paralcaligenes ureilyticus in complex with mn
34% identity, 93% coverage: 39:558/560 of query aligns to 39:554/569 of 8epzA
7m3kA Crystal structure of galactonate dehydratase from brucella melitensis biovar abortus 2308
32% identity, 94% coverage: 23:547/560 of query aligns to 25:552/587 of 7m3kA
Q1JUQ1 L-arabonate dehydratase; L-arabinonate dehydratase; EC 4.2.1.25 from Azospirillum brasilense (see paper)
33% identity, 93% coverage: 39:558/560 of query aligns to 44:568/583 of Q1JUQ1
5oynA Crystal structure of d-xylonate dehydratase in holo-form (see paper)
33% identity, 92% coverage: 23:537/560 of query aligns to 30:550/589 of 5oynA
Q9A9Z2 D-xylonate dehydratase; XyDHT; Gluconate dehydratase; EC 4.2.1.82; EC 4.2.1.39 from Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus) (see 2 papers)
33% identity, 92% coverage: 23:537/560 of query aligns to 36:556/595 of Q9A9Z2
>CA265_RS15795 FitnessBrowser__Pedo557:CA265_RS15795
MSELNKYSKTFTQDPTQPAAQAMLYGIGLTDADMAKAQVGIASMGYDGNTCNMHLNDLAK
DVKKGVWKNDLVGLVFNTIGVSDGMSNGTDGMRYSLVSRDVIADSIETICGGQYYDGIIS
IPGCDKNMPGAIMAMARLDRPSIMVYGGTIAPGHYKGEELNIVSAFEALGQKICGNLSEE
DYQGIIKHTCPGAGACGGMYTANTMASAIEALGMSLPYSSSNPAISEEKKQECLDAGKYI
KILLEKDIKPSDIMTRKAFENAIRSIIILGGSTNAVLHFIAMGKAIGIEITQDDFQRMSD
VTPVLADFKPSGKYLMQDLHQYGGIPAVLKYLLNEGLLHGDCLTVTGKTVAENLADVKSI
MDYDQKIIQKLSEPIKATGHLQILYGNLAEKGSVAKISGKEGEKFEGPARVFDGEHDLIA
GISSGRVQPGDVIVIKNSGPVGAPGMPEMLKPTSAIIGAGLGKSVALITDGRFSGGTHGF
VVGHITPESYKGGLIGLVEDEDRILIDAVNNIINLQVSDEVIAERRKNYVQPALKVTKGV
LYKYAKTVSDAASGCVTDEY
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory