SitesBLAST
Comparing CA265_RS15805 FitnessBrowser__Pedo557:CA265_RS15805 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P09114 Acetolactate synthase 2, chloroplastic; ALS II; Acetohydroxy-acid synthase II; Acetolactate synthase II; EC 2.2.1.6 from Nicotiana tabacum (Common tobacco) (see paper)
44% identity, 97% coverage: 14:580/583 of query aligns to 77:654/664 of P09114
- P191 (≠ F125) mutation to A: In S4-Hra; highly resistant to sulfonylurea herbicides; when associated with L-568.
- W568 (= W502) mutation to L: In S4-Hra; highly resistant to sulfonylurea herbicides; when associated with A-191.
P09342 Acetolactate synthase 1, chloroplastic; ALS I; Acetohydroxy-acid synthase I; Acetolactate synthase I; EC 2.2.1.6 from Nicotiana tabacum (Common tobacco) (see 2 papers)
43% identity, 99% coverage: 3:580/583 of query aligns to 64:657/667 of P09342
- C161 (≠ V92) modified: Disulfide link with 307
- P194 (≠ F125) mutation to Q: In C3; highly resistant to sulfonylurea herbicides.
- C307 (≠ V237) modified: Disulfide link with 161
7tzzA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase p197t mutant in complex with bispyribac-sodium (see paper)
42% identity, 95% coverage: 26:580/583 of query aligns to 14:575/582 of 7tzzA
- binding 2,6-bis[(4,6-dimethoxypyrimidin-2-yl)oxy]benzoic acid: M266 (= M280), R292 (= R306), W489 (= W502), S568 (≠ Q573)
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V400 (= V413), G401 (= G414), Q402 (= Q415), H403 (= H416), G426 (= G439), M428 (= M441), G452 (= G465), D453 (= D466), G454 (= G467), S455 (≠ G468), L483 (= L496), G484 (= G497), M485 (= M498), V486 (= V499)
- binding flavin-adenine dinucleotide: R161 (= R174), G222 (= G234), G223 (≠ Q235), G224 (= G236), T246 (= T260), L247 (≠ I261), M248 (= M262), M263 (= M277), L264 (= L278), M266 (= M280), H267 (= H281), G286 (= G300), R288 (= R302), V293 (= V307), D310 (= D324), I311 (= I325), D329 (= D343), V330 (≠ C344), M405 (= M418), G423 (= G436)
- binding magnesium ion: A37 (= A49), T82 (= T95), S83 (= S96), Q122 (= Q135), Y381 (≠ E394), D453 (= D466), M458 (= M471), Q461 (= Q474), N480 (= N493), H482 (≠ F495), K533 (≠ R538)
P17597 Acetolactate synthase, chloroplastic; AtALS; Acetohydroxy-acid synthase; Protein CHLORSULFURON RESISTANT 1; EC 2.2.1.6 from Arabidopsis thaliana (Mouse-ear cress) (see 8 papers)
42% identity, 95% coverage: 26:580/583 of query aligns to 99:660/670 of P17597
- A122 (= A49) mutation to V: Reduced catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
- M124 (= M51) mutation to E: Reduced catalytic activity. Resistant to imidazolinone herbicides and reduced sensitivity to sulfonylurea herbicides.; mutation to I: No effect on catalytic activity. Increased resistance to imidazolinone herbicides.
- E144 (= E72) binding
- S186 (= S114) binding
- P197 (≠ F125) mutation to S: In csr1-1/GH50; resistant to sulfonylurea but not to imidazolinone herbicides.
- R199 (≠ H127) mutation R->A,E: No effect on catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
- Q207 (= Q135) binding
- K220 (= K148) binding
- R246 (= R174) binding ; binding
- K256 (= K184) binding
- G308 (≠ Q235) binding
- TL 331:332 (≠ TI 260:261) binding
- C340 (≠ T269) modified: Cysteine sulfinic acid (-SO2H)
- LGMH 349:352 (= LGMH 278:281) binding
- GVRFD 371:375 (≠ GMRFD 300:304) binding
- DR 376:377 (= DR 305:306) binding
- DI 395:396 (= DI 324:325) binding
- DV 414:415 (≠ DC 343:344) binding
- QH 487:488 (= QH 415:416) binding
- GG 508:509 (= GG 436:437) binding
- GAM 511:513 (≠ GTM 439:441) binding
- D538 (= D466) binding
- DGS 538:540 (≠ DGG 466:468) binding
- N565 (= N493) binding
- NQHLGM 565:570 (≠ NRFLGM 493:498) binding
- H567 (≠ F495) binding
- W574 (= W502) binding ; mutation to L: Increased catalytic activity. Resistant to imidazolinone and sulfonylurea herbicides.; mutation to S: Slightly decreased catalytic activity. Resistant to imidazolinone and sulfonylurea herbicides.
- S653 (≠ Q573) binding ; mutation to A: No effect on catalytic activity or sensitivity to herbicides.; mutation to F: No effect on catalytic activity. Resistant to imidazolinone herbicides and also slightly sulfonylurea-resistant.; mutation to N: In csr1-2/GH90; no effect on catalytic activity. Resistant to imidazolinone but not to sulfonylurea herbicides.; mutation to T: No effect on catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
5k2oA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a pyrimidinyl-benzoate herbicide, pyrithiobac (see paper)
42% identity, 95% coverage: 26:580/583 of query aligns to 14:575/585 of 5k2oA
- active site: Y33 (= Y45), G35 (= G47), G36 (= G48), A37 (= A49), S38 (≠ I50), E59 (= E72), T82 (= T95), F121 (= F134), Q122 (= Q135), E123 (= E136), K171 (= K184), M266 (= M280), V293 (= V307), V400 (= V413), G426 (= G439), M428 (= M441), D453 (= D466), N480 (= N493), H482 (≠ F495), L483 (= L496), M485 (= M498), V486 (= V499), W489 (= W502), H558 (≠ R563)
- binding 2-chloranyl-6-(4,6-dimethoxypyrimidin-2-yl)sulfanyl-benzoic acid: M266 (= M280), R292 (= R306), W489 (= W502), S568 (≠ Q573)
- binding flavin-adenine dinucleotide: R161 (= R174), G222 (= G234), G223 (≠ Q235), G224 (= G236), T246 (= T260), L247 (≠ I261), M248 (= M262), L264 (= L278), G286 (= G300), R288 (= R302), D290 (= D304), V293 (= V307), D310 (= D324), I311 (= I325), D329 (= D343), V330 (≠ C344), Q404 (= Q417), M405 (= M418), G423 (= G436)
- binding magnesium ion: D453 (= D466), N480 (= N493), H482 (≠ F495)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (= V413), G401 (= G414), Q402 (= Q415), H403 (= H416), M428 (= M441), D453 (= D466), G454 (= G467), S455 (≠ G468), N480 (= N493), H482 (≠ F495), L483 (= L496), G484 (= G497), M485 (= M498), V486 (= V499)
8et4A Crystal structure of wild-type arabidopsis thaliana acetohydroxyacid synthase in complex with amidosulfuron (see paper)
42% identity, 95% coverage: 26:580/583 of query aligns to 14:575/582 of 8et4A
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V400 (= V413), G401 (= G414), Q402 (= Q415), H403 (= H416), G426 (= G439), M428 (= M441), G452 (= G465), D453 (= D466), G454 (= G467), S455 (≠ G468), M458 (= M471), N480 (= N493), H482 (≠ F495), L483 (= L496), G484 (= G497), M485 (= M498), V486 (= V499)
- binding flavin-adenine dinucleotide: R161 (= R174), G222 (= G234), G223 (≠ Q235), G224 (= G236), T246 (= T260), L247 (≠ I261), M248 (= M262), L264 (= L278), M266 (= M280), H267 (= H281), G286 (= G300), V287 (≠ M301), R288 (= R302), D290 (= D304), R292 (= R306), V293 (= V307), D310 (= D324), I311 (= I325), D329 (= D343), V330 (≠ C344), M405 (= M418), G423 (= G436)
- binding magnesium ion: F370 (≠ Y384), D453 (= D466), M458 (= M471), Q461 (= Q474), N480 (= N493), H482 (≠ F495), K533 (≠ R538)
- binding N-{[(4,6-dimethoxypyrimidin-2-yl)carbamoyl]sulfamoyl}-N-methylmethanesulfonamide: M266 (= M280), R292 (= R306), M485 (= M498), W489 (= W502), S568 (≠ Q573)
5wj1A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a triazolopyrimidine herbicide, penoxsulam (see paper)
42% identity, 95% coverage: 26:580/583 of query aligns to 14:575/582 of 5wj1A
- active site: Y33 (= Y45), G35 (= G47), G36 (= G48), A37 (= A49), S38 (≠ I50), E59 (= E72), T82 (= T95), F121 (= F134), Q122 (= Q135), E123 (= E136), K171 (= K184), M266 (= M280), V293 (= V307), V400 (= V413), G426 (= G439), M428 (= M441), D453 (= D466), N480 (= N493), H482 (≠ F495), L483 (= L496), M485 (= M498), V486 (= V499), W489 (= W502), H558 (≠ R563)
- binding flavin-adenine dinucleotide: R161 (= R174), G222 (= G234), G223 (≠ Q235), G224 (= G236), T246 (= T260), L247 (≠ I261), M248 (= M262), M263 (= M277), L264 (= L278), G286 (= G300), R288 (= R302), V293 (= V307), D310 (= D324), I311 (= I325), D329 (= D343), V330 (≠ C344), M405 (= M418), G423 (= G436), G424 (= G437)
- binding magnesium ion: D453 (= D466), N480 (= N493), H482 (≠ F495)
- binding 2-(2,2-difluoroethoxy)-N-(5,8-dimethoxy[1,2,4]triazolo[1,5-c]pyrimidin-2-yl)-6-(trifluoromethyl)benzenesulfonamide: M266 (= M280), D291 (= D305), R292 (= R306), M485 (= M498), W489 (= W502), S568 (≠ Q573)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (= V413), G401 (= G414), Q402 (= Q415), H403 (= H416), M428 (= M441), D453 (= D466), G454 (= G467), S455 (≠ G468), M458 (= M471), N480 (= N493), H482 (≠ F495), L483 (= L496), G484 (= G497), M485 (= M498), V486 (= V499)
5k6tA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylamino-carbonyl-triazolinone herbicide, propoxycarbazone-sodium (see paper)
42% identity, 95% coverage: 26:580/583 of query aligns to 14:575/582 of 5k6tA
- active site: Y33 (= Y45), G35 (= G47), G36 (= G48), A37 (= A49), S38 (≠ I50), E59 (= E72), T82 (= T95), F121 (= F134), Q122 (= Q135), E123 (= E136), K171 (= K184), M266 (= M280), V293 (= V307), V400 (= V413), G426 (= G439), M428 (= M441), D453 (= D466), N480 (= N493), H482 (≠ F495), L483 (= L496), M485 (= M498), V486 (= V499), W489 (= W502), H558 (≠ R563)
- binding methyl 2-[(4-methyl-5-oxidanylidene-3-propoxy-1,2,4-triazol-1-yl)carbonylsulfamoyl]benzoate: H267 (= H281), R292 (= R306), M485 (= M498), W489 (= W502), S568 (≠ Q573)
- binding flavin-adenine dinucleotide: R161 (= R174), G222 (= G234), G223 (≠ Q235), G224 (= G236), T246 (= T260), L247 (≠ I261), M248 (= M262), L264 (= L278), G286 (= G300), R288 (= R302), D290 (= D304), R292 (= R306), V293 (= V307), D310 (= D324), I311 (= I325), D329 (= D343), V330 (≠ C344), Q404 (= Q417), M405 (= M418), G423 (= G436)
- binding magnesium ion: D453 (= D466), N480 (= N493), H482 (≠ F495)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V400 (= V413), G401 (= G414), Q402 (= Q415), H403 (= H416), G426 (= G439), M428 (= M441), G452 (= G465), G454 (= G467), S455 (≠ G468), N480 (= N493), H482 (≠ F495), L483 (= L496), G484 (= G497)
5k6rA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylamino-carbonyl-triazolinone herbicide, thiencarbazone-methyl (see paper)
42% identity, 95% coverage: 26:580/583 of query aligns to 14:575/582 of 5k6rA
- active site: Y33 (= Y45), G35 (= G47), G36 (= G48), A37 (= A49), S38 (≠ I50), E59 (= E72), T82 (= T95), F121 (= F134), Q122 (= Q135), E123 (= E136), K171 (= K184), M266 (= M280), V293 (= V307), V400 (= V413), G426 (= G439), M428 (= M441), D453 (= D466), N480 (= N493), H482 (≠ F495), L483 (= L496), M485 (= M498), V486 (= V499), W489 (= W502), H558 (≠ R563)
- binding methyl 4-[(3-methoxy-4-methyl-5-oxidanylidene-1,2,4-triazol-1-yl)carbonylsulfamoyl]-5-methyl-thiophene-3-carboxylate: R292 (= R306), W489 (= W502), S568 (≠ Q573)
- binding flavin-adenine dinucleotide: R161 (= R174), G222 (= G234), G223 (≠ Q235), G224 (= G236), T246 (= T260), L247 (≠ I261), M248 (= M262), L264 (= L278), M266 (= M280), G286 (= G300), R288 (= R302), R292 (= R306), V293 (= V307), D310 (= D324), I311 (= I325), G328 (= G342), D329 (= D343), V330 (≠ C344), M405 (= M418), G423 (= G436)
- binding magnesium ion: D453 (= D466), N480 (= N493), H482 (≠ F495)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V400 (= V413), G401 (= G414), Q402 (= Q415), H403 (= H416), G426 (= G439), M428 (= M441), D453 (= D466), G454 (= G467), S455 (≠ G468), M458 (= M471), N480 (= N493), H482 (≠ F495), L483 (= L496), G484 (= G497), M485 (= M498), V486 (= V499)
1z8nA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with an imidazolinone herbicide, imazaquin (see paper)
42% identity, 95% coverage: 26:580/583 of query aligns to 14:575/582 of 1z8nA
- active site: Y33 (= Y45), G35 (= G47), G36 (= G48), A37 (= A49), S38 (≠ I50), E59 (= E72), T82 (= T95), F121 (= F134), Q122 (= Q135), E123 (= E136), K171 (= K184), M266 (= M280), V293 (= V307), V400 (= V413), G426 (= G439), M428 (= M441), D453 (= D466), N480 (= N493), H482 (≠ F495), L483 (= L496), M485 (= M498), V486 (= V499), W489 (= W502), H558 (≠ R563)
- binding 2-(4-isopropyl-4-methyl-5-oxo-4,5-dihydro-1h-imidazol-2-yl)quinoline-3-carboxylic acid: K135 (= K148), R161 (= R174), Y191 (= Y205), R194 (vs. gap), D291 (= D305), R292 (= R306), D312 (= D326), W489 (= W502), G569 (= G574)
- binding flavin-adenine dinucleotide: R161 (= R174), G222 (= G234), G224 (= G236), T246 (= T260), L247 (≠ I261), M248 (= M262), L264 (= L278), G265 (= G279), M266 (= M280), H267 (= H281), G286 (= G300), V287 (≠ M301), R288 (= R302), D290 (= D304), R292 (= R306), V293 (= V307), D310 (= D324), I311 (= I325), D329 (= D343), V330 (≠ C344), M405 (= M418), G423 (= G436), G424 (= G437)
- binding magnesium ion: D453 (= D466), N480 (= N493)
- binding thiamine diphosphate: V400 (= V413), G401 (= G414), Q402 (= Q415), H403 (= H416), G426 (= G439), M428 (= M441), G452 (= G465), G454 (= G467), S455 (≠ G468), N480 (= N493), H482 (≠ F495), L483 (= L496), G484 (= G497), M485 (= M498), V486 (= V499)
1yi1A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, tribenuron methyl (see paper)
42% identity, 95% coverage: 26:580/583 of query aligns to 14:575/582 of 1yi1A
- active site: Y33 (= Y45), G35 (= G47), G36 (= G48), A37 (= A49), S38 (≠ I50), E59 (= E72), T82 (= T95), F121 (= F134), Q122 (= Q135), E123 (= E136), K171 (= K184), M266 (= M280), V293 (= V307), V400 (= V413), G426 (= G439), M428 (= M441), D453 (= D466), N480 (= N493), H482 (≠ F495), L483 (= L496), M485 (= M498), V486 (= V499), W489 (= W502), H558 (≠ R563)
- binding methyl 2-[4-methoxy-6-methyl-1,3,5-trazin-2-yl(methyl)carbamoylsulfamoyl]benzoate: D291 (= D305), R292 (= R306), W489 (= W502), S568 (≠ Q573)
- binding flavin-adenine dinucleotide: R161 (= R174), G223 (≠ Q235), G224 (= G236), T246 (= T260), L247 (≠ I261), M248 (= M262), M263 (= M277), L264 (= L278), G265 (= G279), M266 (= M280), H267 (= H281), G286 (= G300), V287 (≠ M301), R288 (= R302), D290 (= D304), V293 (= V307), D310 (= D324), I311 (= I325), D329 (= D343), V330 (≠ C344), M405 (= M418), G423 (= G436), G424 (= G437)
- binding magnesium ion: D453 (= D466), N480 (= N493), H482 (≠ F495)
1yi0A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, sulfometuron methyl (see paper)
42% identity, 95% coverage: 26:580/583 of query aligns to 14:575/582 of 1yi0A
- active site: Y33 (= Y45), G35 (= G47), G36 (= G48), A37 (= A49), S38 (≠ I50), E59 (= E72), T82 (= T95), F121 (= F134), Q122 (= Q135), E123 (= E136), K171 (= K184), M266 (= M280), V293 (= V307), V400 (= V413), G426 (= G439), M428 (= M441), D453 (= D466), N480 (= N493), H482 (≠ F495), L483 (= L496), M485 (= M498), V486 (= V499), W489 (= W502), H558 (≠ R563)
- binding methyl 2-[({[(4,6-dimethylpyrimidin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: D291 (= D305), R292 (= R306), W489 (= W502), S568 (≠ Q573)
- binding flavin-adenine dinucleotide: R161 (= R174), G222 (= G234), G223 (≠ Q235), G224 (= G236), T246 (= T260), L247 (≠ I261), M248 (= M262), L264 (= L278), G265 (= G279), M266 (= M280), H267 (= H281), G286 (= G300), V287 (≠ M301), R288 (= R302), D290 (= D304), R292 (= R306), V293 (= V307), D310 (= D324), I311 (= I325), G328 (= G342), D329 (= D343), V330 (≠ C344), M405 (= M418), G423 (= G436), G424 (= G437)
- binding magnesium ion: D453 (= D466), N480 (= N493), H482 (≠ F495)
1yhzA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorsulfuron (see paper)
42% identity, 95% coverage: 26:580/583 of query aligns to 14:575/582 of 1yhzA
- active site: Y33 (= Y45), G35 (= G47), G36 (= G48), A37 (= A49), S38 (≠ I50), E59 (= E72), T82 (= T95), F121 (= F134), Q122 (= Q135), E123 (= E136), K171 (= K184), M266 (= M280), V293 (= V307), V400 (= V413), G426 (= G439), M428 (= M441), D453 (= D466), N480 (= N493), H482 (≠ F495), L483 (= L496), M485 (= M498), V486 (= V499), W489 (= W502), H558 (≠ R563)
- binding 1-(2-chlorophenylsulfonyl)-3-(4-methoxy-6-methyl-l,3,5-triazin-2-yl)urea: D291 (= D305), R292 (= R306), M485 (= M498), W489 (= W502), S568 (≠ Q573)
- binding flavin-adenine dinucleotide: R161 (= R174), G223 (≠ Q235), G224 (= G236), T246 (= T260), L247 (≠ I261), M248 (= M262), L264 (= L278), M266 (= M280), H267 (= H281), G286 (= G300), V287 (≠ M301), R288 (= R302), D290 (= D304), V293 (= V307), D310 (= D324), I311 (= I325), D329 (= D343), V330 (≠ C344), Q404 (= Q417), M405 (= M418), G423 (= G436), G424 (= G437)
- binding magnesium ion: D453 (= D466), N480 (= N493), H482 (≠ F495)
1yhyA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, metsulfuron methyl (see paper)
42% identity, 95% coverage: 26:580/583 of query aligns to 14:575/582 of 1yhyA
- active site: Y33 (= Y45), G35 (= G47), G36 (= G48), A37 (= A49), S38 (≠ I50), E59 (= E72), T82 (= T95), F121 (= F134), Q122 (= Q135), E123 (= E136), K171 (= K184), M266 (= M280), V293 (= V307), V400 (= V413), G426 (= G439), M428 (= M441), D453 (= D466), N480 (= N493), H482 (≠ F495), L483 (= L496), M485 (= M498), V486 (= V499), W489 (= W502), H558 (≠ R563)
- binding methyl 2-[({[(4-methoxy-6-methyl-1,3,5-triazin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: D291 (= D305), R292 (= R306), V486 (= V499), W489 (= W502), S568 (≠ Q573)
- binding flavin-adenine dinucleotide: R161 (= R174), G222 (= G234), G223 (≠ Q235), G224 (= G236), T246 (= T260), L247 (≠ I261), M248 (= M262), L264 (= L278), G265 (= G279), M266 (= M280), H267 (= H281), G286 (= G300), V287 (≠ M301), R288 (= R302), D290 (= D304), V293 (= V307), D310 (= D324), I311 (= I325), D329 (= D343), V330 (≠ C344), Q404 (= Q417), M405 (= M418), G423 (= G436), G424 (= G437)
- binding magnesium ion: D453 (= D466), N480 (= N493), H482 (≠ F495)
1ybhA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide chlorimuron ethyl (see paper)
42% identity, 95% coverage: 26:580/583 of query aligns to 14:575/582 of 1ybhA
- active site: Y33 (= Y45), G35 (= G47), G36 (= G48), A37 (= A49), S38 (≠ I50), E59 (= E72), T82 (= T95), F121 (= F134), Q122 (= Q135), E123 (= E136), K171 (= K184), M266 (= M280), V293 (= V307), V400 (= V413), G426 (= G439), M428 (= M441), D453 (= D466), N480 (= N493), H482 (≠ F495), L483 (= L496), M485 (= M498), V486 (= V499), W489 (= W502), H558 (≠ R563)
- binding 2-[[[[(4-chloro-6-methoxy-2-pyrimidinyl)amino]carbonyl]amino]sulfonyl]benzoic acid ethyl ester: M266 (= M280), D291 (= D305), R292 (= R306), M485 (= M498), W489 (= W502), S568 (≠ Q573)
- binding flavin-adenine dinucleotide: R161 (= R174), G223 (≠ Q235), G224 (= G236), T246 (= T260), L247 (≠ I261), M248 (= M262), L264 (= L278), M266 (= M280), H267 (= H281), G286 (= G300), V287 (≠ M301), R288 (= R302), D290 (= D304), V293 (= V307), D310 (= D324), I311 (= I325), D329 (= D343), V330 (≠ C344), Q404 (= Q417), M405 (= M418), G423 (= G436), G424 (= G437)
- binding magnesium ion: D453 (= D466), N480 (= N493), H482 (≠ F495)
5k3sA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a pyrimidinyl-benzoate herbicide, bispyribac-sodium (see paper)
42% identity, 95% coverage: 26:580/583 of query aligns to 14:575/583 of 5k3sA
- active site: Y33 (= Y45), G35 (= G47), G36 (= G48), A37 (= A49), S38 (≠ I50), E59 (= E72), T82 (= T95), F121 (= F134), Q122 (= Q135), E123 (= E136), K171 (= K184), M266 (= M280), V293 (= V307), V400 (= V413), G426 (= G439), M428 (= M441), D453 (= D466), N480 (= N493), H482 (≠ F495), L483 (= L496), M485 (= M498), V486 (= V499), W489 (= W502), H558 (≠ R563)
- binding 2,6-bis[(4,6-dimethoxypyrimidin-2-yl)oxy]benzoic acid: R292 (= R306), M485 (= M498), W489 (= W502), G569 (= G574)
- binding flavin-adenine dinucleotide: R161 (= R174), G222 (= G234), G223 (≠ Q235), G224 (= G236), T246 (= T260), L247 (≠ I261), M248 (= M262), L264 (= L278), M266 (= M280), G286 (= G300), R288 (= R302), D290 (= D304), V293 (= V307), D310 (= D324), I311 (= I325), D329 (= D343), V330 (≠ C344), M405 (= M418), G423 (= G436)
- binding magnesium ion: D453 (= D466), N480 (= N493), H482 (≠ F495)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (= V413), G401 (= G414), Q402 (= Q415), H403 (= H416), G426 (= G439), M428 (= M441), D453 (= D466), G454 (= G467), S455 (≠ G468), N480 (= N493), H482 (≠ F495), L483 (= L496), G484 (= G497), M485 (= M498), V486 (= V499)
3ea4A Arabidopsis thaliana acetohydroxyacid synthase in complex with monosulfuron-ester (see paper)
42% identity, 95% coverage: 26:580/583 of query aligns to 13:574/582 of 3ea4A
- active site: Y32 (= Y45), G34 (= G47), G35 (= G48), A36 (= A49), S37 (≠ I50), E58 (= E72), T81 (= T95), F120 (= F134), Q121 (= Q135), E122 (= E136), K170 (= K184), M265 (= M280), V292 (= V307), V399 (= V413), G425 (= G439), M427 (= M441), D452 (= D466), N479 (= N493), H481 (≠ F495), L482 (= L496), M484 (= M498), V485 (= V499), W488 (= W502), H557 (≠ R563)
- binding methyl 2-{[(4-methylpyrimidin-2-yl)carbamoyl]sulfamoyl}benzoate: D290 (= D305), R291 (= R306), W488 (= W502), S567 (≠ Q573)
- binding flavin-adenine dinucleotide-n5-isobutyl ketone: R160 (= R174), G221 (= G234), G222 (≠ Q235), G223 (= G236), T245 (= T260), L246 (≠ I261), M247 (= M262), L263 (= L278), G264 (= G279), M265 (= M280), H266 (= H281), G285 (= G300), R287 (= R302), D289 (= D304), R291 (= R306), D309 (= D324), I310 (= I325), G327 (= G342), D328 (= D343), V329 (≠ C344), M404 (= M418), G422 (= G436)
- binding magnesium ion: D452 (= D466), N479 (= N493), H481 (≠ F495)
- binding 2-[(2e)-3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-(1-hydroxyethylidene)-4-methyl-2,3-dihydro-1,3-thiazol-5-yl]ethyltrihydrogen diphosphate: V399 (= V413), G400 (= G414), Q401 (= Q415), H402 (= H416), M427 (= M441), G451 (= G465), D452 (= D466), G453 (= G467), S454 (≠ G468), N479 (= N493), H481 (≠ F495), L482 (= L496), G483 (= G497), M484 (= M498), V485 (= V499)
3e9yA Arabidopsis thaliana acetohydroxyacid synthase in complex with monosulfuron (see paper)
42% identity, 95% coverage: 26:580/583 of query aligns to 13:574/582 of 3e9yA
- active site: Y32 (= Y45), G34 (= G47), G35 (= G48), A36 (= A49), S37 (≠ I50), E58 (= E72), T81 (= T95), F120 (= F134), Q121 (= Q135), E122 (= E136), K170 (= K184), M265 (= M280), V292 (= V307), V399 (= V413), G425 (= G439), M427 (= M441), D452 (= D466), N479 (= N493), H481 (≠ F495), L482 (= L496), M484 (= M498), V485 (= V499), W488 (= W502), H557 (≠ R563)
- binding N-[(4-methylpyrimidin-2-yl)carbamoyl]-2-nitrobenzenesulfonamide: D290 (= D305), R291 (= R306), W488 (= W502), S567 (≠ Q573)
- binding flavin-adenine dinucleotide-n5-isobutyl ketone: R160 (= R174), G221 (= G234), G222 (≠ Q235), G223 (= G236), T245 (= T260), L246 (≠ I261), M247 (= M262), L263 (= L278), G285 (= G300), R287 (= R302), D289 (= D304), R291 (= R306), D309 (= D324), I310 (= I325), G327 (= G342), D328 (= D343), V329 (≠ C344), M404 (= M418), G422 (= G436)
- binding magnesium ion: D452 (= D466), N479 (= N493), H481 (≠ F495)
- binding 2-[(2e)-3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-(1-hydroxyethylidene)-4-methyl-2,3-dihydro-1,3-thiazol-5-yl]ethyltrihydrogen diphosphate: V399 (= V413), G400 (= G414), Q401 (= Q415), H402 (= H416), M427 (= M441), G451 (= G465), G453 (= G467), S454 (≠ G468), N479 (= N493), H481 (≠ F495), L482 (= L496), G483 (= G497), M484 (= M498), V485 (= V499)
6deqA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide penoxsulam (see paper)
39% identity, 96% coverage: 25:582/583 of query aligns to 15:580/601 of 6deqA
- active site: Y35 (= Y45), G37 (= G47), G38 (= G48), A39 (= A49), I40 (= I50), E61 (= E72), T84 (= T95), F123 (= F134), Q124 (= Q135), E125 (= E136), K173 (= K184), K232 (≠ E244), M268 (= M280), V295 (= V307), V411 (= V413), L436 (= L438), G437 (= G439), M439 (= M441), D464 (= D466), N491 (= N493), E493 (≠ F495), Q494 (≠ L496), M496 (= M498), V497 (= V499), W500 (= W502), L522 (= L524), N527 (≠ Y529), V528 (≠ I530)
- binding flavin-adenine dinucleotide: R163 (= R174), G221 (= G234), A222 (≠ Q235), G223 (= G236), N226 (≠ L239), T248 (= T260), L249 (≠ I261), Q250 (≠ M262), L266 (= L278), G288 (= G300), A289 (≠ M301), R290 (= R302), D292 (= D304), R294 (= R306), V295 (= V307), E321 (≠ D324), I322 (= I325), D340 (= D343), V341 (≠ C344), M416 (= M418), G434 (= G436)
- binding magnesium ion: D464 (= D466), N491 (= N493), E493 (≠ F495)
- binding 2-(2,2-difluoroethoxy)-N-(5,8-dimethoxy[1,2,4]triazolo[1,5-c]pyrimidin-2-yl)-6-(trifluoromethyl)benzenesulfonamide: M268 (= M280), R294 (= R306), M496 (= M498), V497 (= V499), W500 (= W502), A571 (≠ Q573)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V411 (= V413), G412 (= G414), Q413 (= Q415), H414 (= H416), M439 (= M441), G463 (= G465), D464 (= D466), A465 (≠ G467), S466 (≠ G468), N491 (= N493), E493 (≠ F495), Q494 (≠ L496), G495 (= G497), M496 (= M498), V497 (= V499)
6demA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide bensulfuron methyl (see paper)
39% identity, 96% coverage: 25:582/583 of query aligns to 13:576/597 of 6demA
- active site: Y33 (= Y45), G35 (= G47), G36 (= G48), A37 (= A49), I38 (= I50), E59 (= E72), T82 (= T95), F121 (= F134), Q122 (= Q135), E123 (= E136), K171 (= K184), K228 (≠ E244), M264 (= M280), V291 (= V307), V407 (= V413), L432 (= L438), G433 (= G439), M435 (= M441), D460 (= D466), N487 (= N493), E489 (≠ F495), Q490 (≠ L496), M492 (= M498), V493 (= V499), W496 (= W502), L518 (= L524), N523 (≠ Y529), V524 (≠ I530)
- binding methyl 2-[(4,6-dimethoxypyrimidin-2-yl)carbamoylsulfamoylmethyl]benzoate: M264 (= M280), D289 (= D305), R290 (= R306), M492 (= M498), W496 (= W502), A567 (≠ Q573)
- binding flavin-adenine dinucleotide: R161 (= R174), G217 (= G234), A218 (≠ Q235), G219 (= G236), N222 (≠ L239), T244 (= T260), L245 (≠ I261), Q246 (≠ M262), L262 (= L278), G284 (= G300), A285 (≠ M301), R286 (= R302), D288 (= D304), R290 (= R306), V291 (= V307), E317 (≠ D324), I318 (= I325), N322 (≠ E329), D336 (= D343), V337 (≠ C344), M412 (= M418), G430 (= G436)
- binding magnesium ion: D460 (= D466), N487 (= N493), E489 (≠ F495)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V407 (= V413), G408 (= G414), Q409 (= Q415), H410 (= H416), M435 (= M441), G459 (= G465), D460 (= D466), A461 (≠ G467), S462 (≠ G468), M465 (= M471), N487 (= N493), E489 (≠ F495), Q490 (≠ L496), G491 (= G497), M492 (= M498), V493 (= V499)
Query Sequence
>CA265_RS15805 FitnessBrowser__Pedo557:CA265_RS15805
METAQDTIQQNEAKAETSKTLFKGTGSQVLLNGLIEEGVTTIFGYPGGAIMPIYDALYDY
ADKLEHILVRHEQGGIHAAQGFARASGEVGVVFATSGPGATNLVTGLADAQIDSTPLVCI
TGQVFAHLLGTDAFQETDVINITTPVTKWNYQVTDAKEIQEVLAKAFYIAKSGRPGPVLI
DITKNAQLQLEEFPEYVKCNHIRSYRPKPKVRIEYIEQAAELINSAKKPFVLFGQGVILG
SAEEEFKAFINKTGIPAAWTIMGEGAIPTSHPLNVGMLGMHGNYGPNVLTNEADVIIAIG
MRFDDRVTGRLDKYAKQARVVHLDIDPAEIDKNVKAEVGVWGDCKETLPLLTNLVNENKH
EDWLAKFRQYNQEEIDQVITPELYPTGDEMTMGEVLRNINEICGGDAVIVTDVGQHQMVA
CRYAKFNNTRSNITSGGLGTMGFGLPAAIGAKYGAPDKTVIAIIGDGGFQMTPQELGTIM
QFGAAVKILILNNRFLGMVRQWQQLFHDKRYSFVNITSPDFVALAKSYYIEASKVDERAN
LRQALETMINHEGSYLLEVMVGRENNVFPMVPQGMSVSEIRLK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory