SitesBLAST
Comparing CA265_RS15855 CA265_RS15855 2-isopropylmalate synthase to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9JZG1 2-isopropylmalate synthase; Alpha-IPM synthase; Alpha-isopropylmalate synthase; EC 2.3.3.13 from Neisseria meningitidis serogroup B (strain MC58) (see 2 papers)
50% identity, 98% coverage: 6:382/386 of query aligns to 5:383/517 of Q9JZG1
- D16 (= D17) binding
- H204 (= H205) binding
- H206 (= H207) binding
- N240 (= N241) binding
Sites not aligning to the query:
- 366:517 Required for the condensation reaction. Not required to bind substrate
Q9FG67 Methylthioalkylmalate synthase 1, chloroplastic; 2-isopropylmalate synthase 3; EC 2.3.3.17 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
48% identity, 98% coverage: 2:381/386 of query aligns to 79:474/506 of Q9FG67
- S102 (≠ Q25) mutation to F: In gsm1-1; loss of conversion of C3 to C4 glucosinolates.
- A290 (≠ S203) mutation to T: In gsm1-2; loss of conversion of C3 to C4 glucosinolates.
6e1jA Crystal structure of methylthioalkylmalate synthase (bjumam1.1) from brassica juncea (see paper)
47% identity, 99% coverage: 2:382/386 of query aligns to 12:408/409 of 6e1jA
- binding coenzyme a: Q30 (= Q20), F60 (= F50), S63 (= S53), I95 (≠ L76), R97 (= R78), F121 (≠ G102), K132 (= K113), L133 (≠ F114), S322 (= S299), G323 (= G300), I324 (= I301), D327 (= D304), K331 (= K308), L359 (≠ R333), R362 (= R336), H363 (= H337)
- binding 4-(methylsulfanyl)-2-oxobutanoic acid: P192 (= P172), T194 (= T174), H225 (= H205), H227 (= H207)
- binding manganese (ii) ion: D27 (= D17), V82 (vs. gap), E84 (vs. gap), H225 (= H205), H227 (= H207)
Q9FN52 Methylthioalkylmalate synthase 3, chloroplastic; 2-isopropylmalate synthase 2; Methylthioalkylmalate synthase-like; EC 2.3.3.17 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
45% identity, 97% coverage: 6:381/386 of query aligns to 83:474/503 of Q9FN52
- G263 (= G176) mutation to E: In gsm2-1; loss of activity and lack of C6, C7 and C8 aliphatic glucosinolates.
3rmjB Crystal structure of truncated alpha-isopropylmalate synthase from neisseria meningitidis (see paper)
50% identity, 82% coverage: 6:323/386 of query aligns to 2:307/308 of 3rmjB
6ktqA Crystal structure of catalytic domain of homocitrate synthase from sulfolobus acidocaldarius (sahcs(dram)) in complex with alpha- ketoglutarate/zn2+/coa (see paper)
38% identity, 91% coverage: 7:358/386 of query aligns to 21:365/399 of 6ktqA
- binding 2-oxoglutaric acid: R30 (= R16), R154 (≠ E140), T156 (≠ Y142), E158 (= E144), S184 (≠ N170), T188 (= T174), H216 (= H205), H218 (= H207)
- binding coenzyme a: V67 (≠ S53), R96 (= R78), A97 (= A79), F116 (≠ G102), H128 (≠ F114), E158 (= E144)
- binding zinc ion: E31 (≠ D17), H216 (= H205), H218 (= H207)
4ov4A Isopropylmalate synthase binding with ketoisovalerate (see paper)
36% identity, 90% coverage: 5:353/386 of query aligns to 1:348/379 of 4ov4A
4ov9A Structure of isopropylmalate synthase binding with alpha- isopropylmalate (see paper)
36% identity, 90% coverage: 5:353/386 of query aligns to 1:350/380 of 4ov9A
3ivsA Homocitrate synthase lys4 (see paper)
29% identity, 93% coverage: 6:364/386 of query aligns to 10:347/364 of 3ivsA
3ivtB Homocitrate synthase lys4 bound to 2-og (see paper)
30% identity, 88% coverage: 6:346/386 of query aligns to 28:360/400 of 3ivtB
Q9Y823 Homocitrate synthase, mitochondrial; HCS; EC 2.3.3.14 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see 2 papers)
30% identity, 88% coverage: 6:346/386 of query aligns to 33:365/418 of Q9Y823
- R43 (= R16) binding ; mutation R->A,K,Q: Abolishes the catalytic activity.
- E44 (≠ D17) binding ; binding ; binding
- Q47 (= Q20) mutation to A: Abolishes the catalytic activity.
- E74 (= E47) mutation to A: Abolishes the catalytic activity.; mutation to Q: Results in a moderate decrease in the turnover number and a slight increase in the Km value for each substrate.
- H103 (≠ L76) binding ; mutation to A: Substantially impairs catalytic efficiency.
- D123 (≠ H100) binding ; mutation to N: Does not affect the catalytic activity but impairs L-lysine inhibition.
- R163 (≠ E140) binding ; mutation R->A,Q: Abolishes the catalytic activity.; mutation to K: Severely diminishes affinity for 2-oxoglutarate and substantially impairs catalytic efficiency.
- S165 (≠ Y142) binding ; mutation to A: Results in a moderate decrease in catalytic efficiency.
- E167 (= E144) mutation E->A,Q: Abolishes the catalytic activity.
- T197 (= T174) binding ; binding ; mutation to A: Exhibits a 25-fold decrease in catalytic efficiency.; mutation to S: Results in a modest decrease in catalytic efficiency.; mutation to V: Abolishes the catalytic activity.
- E222 (≠ S203) mutation to Q: Does not affect the catalytic activity but impairs L-lysine inhibition.
- H224 (= H205) binding ; binding
- H226 (= H207) binding ; binding
- R288 (≠ Y269) mutation to K: Does not affect the catalytic activity but impairs L-lysine inhibition.
- Y332 (= Y313) mutation to A: Abolishes the catalytic activity.; mutation to F: Results in a decrease in catalytic efficiency.
- Q364 (≠ R345) mutation to R: Does not affect the catalytic activity but impairs L-lysine inhibition.
3mi3A Homocitrate synthase lys4 bound to lysine (see paper)
30% identity, 88% coverage: 6:346/386 of query aligns to 10:331/370 of 3mi3A
O87198 Homocitrate synthase; HCS; EC 2.3.3.14 from Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) (see paper)
30% identity, 96% coverage: 10:381/386 of query aligns to 6:370/376 of O87198
- R12 (= R16) binding
- E13 (≠ D17) binding
- H72 (≠ P71) binding ; mutation to L: Significant decrease in sensitivity to lysine inhibition. Large decrease in affinity for 2-oxoglutarate. Almost no effect on affinity for acetyl-CoA and on turnover number.
- D92 (= D107) binding
- R133 (vs. gap) binding
- S135 (≠ Y142) binding
- T166 (= T174) binding ; binding
- H195 (= H205) binding
- H197 (= H207) binding
2zyfA Crystal structure of homocitrate synthase from thermus thermophilus complexed with magnesuim ion and alpha-ketoglutarate (see paper)
31% identity, 83% coverage: 10:329/386 of query aligns to 6:313/314 of 2zyfA
2ztjA Crystal structure of homocitrate synthase from thermus thermophilus complexed with alpha-ketoglutarate (see paper)
31% identity, 83% coverage: 10:329/386 of query aligns to 6:311/312 of 2ztjA
3a9iA Crystal structure of homocitrate synthase from thermus thermophilus complexed with lys (see paper)
31% identity, 81% coverage: 10:322/386 of query aligns to 5:305/347 of 3a9iA
Q8F3Q1 (R)-citramalate synthase CimA; LiCMS; EC 2.3.3.21 from Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) (see 2 papers)
27% identity, 98% coverage: 6:382/386 of query aligns to 6:381/516 of Q8F3Q1
- R16 (= R16) mutation R->K,Q: Loss of activity.
- RD 16:17 (= RD 16:17) binding
- D17 (= D17) mutation to A: 34-fold increase in Km for pyruvate and 315-fold decrease in kcat.; mutation to N: 4.4-fold increase in Km for pyruvate and 480-fold decrease in kcat.
- L81 (≠ C74) mutation to A: 4.7-fold increase in Km for pyruvate and 15.7-fold decrease in kcat.; mutation to V: 3.3-fold increase in Km for pyruvate and 10.1-fold decrease in kcat.
- F83 (≠ L76) mutation to A: 5-fold increase in Km for acetyl-CoA and 120-fold decrease in kcat.
- L104 (≠ A94) mutation to V: 1.8-fold increase in Km for pyruvate and 3.4-fold decrease in kcat.
- Y144 (= Y142) binding ; mutation to L: 259-fold increase in Km for pyruvate and 76-fold decrease in kcat.; mutation to V: 114-fold increase in Km for pyruvate and 5.3-fold decrease in kcat.
- E146 (= E144) mutation E->D,Q: Minor effects on the binding of acetyl-CoA, but causes a strong decrease in kcat.
- T179 (= T174) binding ; mutation to A: 16.4-fold increase in Km for pyruvate and 186-fold decrease in kcat.
- H302 (= H302) mutation H->A,N: Loss of activity.
- D304 (= D304) mutation to A: 5.2-fold increase in Km for acetyl-CoA and 16.6-fold decrease in kcat.
- N310 (≠ R310) mutation to A: 2.2-fold increase in Km for acetyl-CoA and 1.7-fold decrease in kcat.
- L311 (≠ E311) mutation to A: 8-fold increase in Km for acetyl-CoA and 6-fold decrease in kcat.
- Y312 (≠ N312) mutation to A: Loss of activity.
Sites not aligning to the query:
- 430 Y→L: No change in Km for acetyl-CoA and 2.3-fold decrease in kcat. Severely impairs inhibition by isoleucine.
- 431 D→A: 1.8-fold decrease in Km for acetyl-CoA and 5-fold decrease in kcat.
- 451 L→V: 1.5-fold increase in Km for acetyl-CoA and 4.3 decrease in kcat.
- 454 Y→A: 1.4 decrease in Km for acetyl-CoA and 17-fold decrease in kcat. Still inhibited by isoleucine and weakly inhibited by leucine.
- 458 I→A: 1.3-fold decrease in Km for acetyl-CoA and 14-fold decrease in kcat. Abolishes inhibition by isoleucine.
- 464 T→A: 1.8-fold decrease in Km for acetyl-CoA and 4.3-fold decrease in kcat.
- 468 V→A: No change in Km for acetyl-CoA and 2-fold decrease in kcat. Increases inhibition by isoleucine and leucine becomes an effective inhibitor.
- 493 P→A: 1.5-fold decrease in Km for acetyl-CoA and 2.6-fold decrease in kcat.
- 495 Q→A: 1.6-fold decrease in Km for acetyl-CoA and 2.8-fold decrease in kcat.
3bliA Crystal structure of the catalytic domain of licms in complexed with pyruvate and acetyl-coa (see paper)
27% identity, 77% coverage: 7:302/386 of query aligns to 1:296/311 of 3bliA
3figB Crystal structure of leucine-bound leua from mycobacterium tuberculosis (see paper)
27% identity, 76% coverage: 15:308/386 of query aligns to 62:368/577 of 3figB
Sites not aligning to the query:
3hq1A Crystal structure of mycobacterium tuberculosis leua complexed with citrate and mn2+
27% identity, 76% coverage: 15:308/386 of query aligns to 62:368/573 of 3hq1A
Query Sequence
>CA265_RS15855 CA265_RS15855 2-isopropylmalate synthase
MIHDPNKVYIFDTTLRDGEQVPGCQLDTNQKVEIAKSLELLGVDVIEAGFPVSSPGDFNS
VIELSKAVTNPIICALTRANKNDIDVAADALRYAKRPRIHTGIGSSDFHIKHKFNSTREE
ILERAVEAVRYSKKFVEDVEFYAEDAGRADIEFLAKMVEAVIAAGATVVNIPDTNGYCLP
DQYGSKILFLKENVKNIDKAIISVHCHNDLGLATANSIAGLQNGARQVECTINGIGERAG
NTSMEEVVMILKTHKILGLNTQIDATRFYEMSHMVRNQMNMPVQPNKAIVGGNAFSHSSG
IHQDGFLKNRENYEIIKPEDVGFPDATIVLTARSGRHALKHHLDRLGHKLEKDHLDIVYK
QFLVLADSKQGINDQDLNQLVALHLA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory