SitesBLAST
Comparing CA265_RS15880 FitnessBrowser__Pedo557:CA265_RS15880 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
38% identity, 72% coverage: 6:241/330 of query aligns to 4:242/353 of 1oxvD
1oxvA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
38% identity, 72% coverage: 6:241/330 of query aligns to 4:242/353 of 1oxvA
1oxuA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
38% identity, 72% coverage: 6:241/330 of query aligns to 4:242/353 of 1oxuA
Q97UY8 Glucose import ATP-binding protein GlcV; EC 7.5.2.- from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
38% identity, 72% coverage: 6:241/330 of query aligns to 4:242/353 of Q97UY8
- S142 (= S141) mutation to A: Decrease in ATPase activity. Can form dimers.
- G144 (= G143) mutation to A: Loss of ATPase activity. Cannot form dimers. Forms an active heterodimer; when associated with A-166.
- E166 (= E165) mutation to A: Loss of ATPase activity. Can form dimers in the presence of ATP-Mg(2+). Forms an active heterodimer; when associated with A-144.; mutation to Q: Strong decrease in ATPase activity. Can form dimers in the presence of ATP alone, without Mg(2+).
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
35% identity, 67% coverage: 22:243/330 of query aligns to 21:246/375 of 2d62A
1g291 Malk (see paper)
35% identity, 67% coverage: 23:242/330 of query aligns to 19:242/372 of 1g291
- binding magnesium ion: D69 (≠ G73), E71 (≠ D75), K72 (≠ E76), K79 (≠ G81), D80 (≠ H82)
- binding pyrophosphate 2-: S38 (= S42), G39 (= G43), C40 (≠ S44), G41 (= G45), K42 (= K46), T43 (≠ S47), T44 (= T48)
Sites not aligning to the query:
1vciA Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp (see paper)
35% identity, 72% coverage: 6:241/330 of query aligns to 7:230/353 of 1vciA
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
34% identity, 72% coverage: 6:242/330 of query aligns to 3:235/371 of 3puyA
- binding phosphoaminophosphonic acid-adenylate ester: W12 (≠ Y15), S37 (= S42), G38 (= G43), C39 (≠ S44), G40 (= G45), K41 (= K46), S42 (= S47), T43 (= T48), Q81 (= Q90), R128 (≠ K135), A132 (≠ E139), S134 (= S141), G136 (= G143), Q137 (≠ E144), E158 (= E165), H191 (= H198)
- binding magnesium ion: S42 (= S47), Q81 (= Q90)
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
34% identity, 72% coverage: 6:242/330 of query aligns to 3:235/371 of 3puxA
- binding adenosine-5'-diphosphate: W12 (≠ Y15), G38 (= G43), C39 (≠ S44), G40 (= G45), K41 (= K46), S42 (= S47), T43 (= T48), R128 (≠ K135), S134 (= S141), Q137 (≠ E144)
- binding beryllium trifluoride ion: S37 (= S42), G38 (= G43), K41 (= K46), Q81 (= Q90), S134 (= S141), G136 (= G143), H191 (= H198)
- binding magnesium ion: S42 (= S47), Q81 (= Q90)
3puwA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4 (see paper)
34% identity, 72% coverage: 6:242/330 of query aligns to 3:235/371 of 3puwA
- binding adenosine-5'-diphosphate: W12 (≠ Y15), V17 (≠ A20), G38 (= G43), C39 (≠ S44), G40 (= G45), K41 (= K46), S42 (= S47), T43 (= T48), R128 (≠ K135), A132 (≠ E139), S134 (= S141), Q137 (≠ E144)
- binding tetrafluoroaluminate ion: S37 (= S42), G38 (= G43), K41 (= K46), Q81 (= Q90), S134 (= S141), G135 (= G142), G136 (= G143), E158 (= E165), H191 (= H198)
- binding magnesium ion: S42 (= S47), Q81 (= Q90)
3puvA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4 (see paper)
34% identity, 72% coverage: 6:242/330 of query aligns to 3:235/371 of 3puvA
- binding adenosine-5'-diphosphate: W12 (≠ Y15), V17 (≠ A20), G38 (= G43), C39 (≠ S44), G40 (= G45), K41 (= K46), S42 (= S47), T43 (= T48), R128 (≠ K135), A132 (≠ E139), S134 (= S141), Q137 (≠ E144)
- binding magnesium ion: S42 (= S47), Q81 (= Q90)
2awnB Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
34% identity, 72% coverage: 6:242/330 of query aligns to 3:235/374 of 2awnB
P68187 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Escherichia coli (strain K12) (see 5 papers)
34% identity, 72% coverage: 6:242/330 of query aligns to 4:236/371 of P68187
- A85 (≠ S93) mutation to M: Suppressor of EAA loop mutations in MalFG.
- K106 (= K114) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V114 (≠ T120) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V117 (≠ I123) mutation to M: Suppressor of EAA loop mutations in MalFG.
- E119 (= E125) mutation to K: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- A124 (≠ L130) mutation to T: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G137 (= G143) mutation to A: Loss of maltose transport. Has greater ability to decrease mal gene expression than wild-type MalK.
- D158 (= D164) mutation to N: Loss of maltose transport but retains ability to repress mal genes.
- R228 (≠ I234) mutation to C: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
Sites not aligning to the query:
- 241 F→I: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 267 W→G: Normal maltose transport but constitutive mal gene expression.
- 278 G→P: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 282 S→L: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 284 G→S: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 302 G→D: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 308 E→Q: Maltose transport is affected but retains ability to interact with MalT.
- 322 S→F: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 340 G→A: Maltose transport is affected but retains ability to interact with MalT.
- 346 G→S: Normal maltose transport but constitutive mal gene expression.
- 355 F→Y: Maltose transport is affected but retains ability to interact with MalT.
1q12A Crystal structure of the atp-bound e. Coli malk (see paper)
34% identity, 72% coverage: 6:242/330 of query aligns to 1:233/367 of 1q12A
- binding adenosine-5'-triphosphate: W10 (≠ Y15), S35 (= S42), G36 (= G43), C37 (≠ S44), G38 (= G45), K39 (= K46), S40 (= S47), T41 (= T48), R126 (≠ K135), A130 (≠ E139), S132 (= S141), G134 (= G143), Q135 (≠ E144)
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
33% identity, 72% coverage: 6:242/330 of query aligns to 4:236/369 of P19566
- L86 (= L94) mutation to F: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- P160 (= P166) mutation to L: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- D165 (= D171) mutation to N: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
Sites not aligning to the query:
- 306 E→K: Loss of transport. No effect on ATP-binding and ATP hydrolysis. Retains repressor activity.
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
32% identity, 75% coverage: 23:270/330 of query aligns to 33:283/378 of P69874
- F45 (≠ V35) mutation to L: Lower ATPase activity and transport efficiency.
- C54 (≠ S44) mutation to T: Loss of ATPase activity and transport.
- L60 (= L50) mutation to F: Lower ATPase activity and transport efficiency.
- L76 (≠ F66) mutation to P: Lower ATPase activity and transport efficiency.
- V135 (≠ L130) mutation to M: Loss of ATPase activity and transport.
- D172 (= D164) mutation to N: Loss of ATPase activity and transport.
- C276 (≠ V263) mutation to A: Lower ATPase activity and transport efficiency.
Sites not aligning to the query:
- 26 C→A: Lower ATPase activity and transport efficiency.
- 27 F→L: Lower ATPase activity and transport efficiency.
- 297 mutation E->K,D: Lower ATPase activity and transport efficiency.; E→Q: Loss of ATPase activity and transport.
8hprD Lpqy-sugabc in state 4 (see paper)
32% identity, 81% coverage: 6:272/330 of query aligns to 3:267/362 of 8hprD
- binding adenosine-5'-triphosphate: Y12 (= Y15), S38 (= S42), C40 (≠ S44), G41 (= G45), K42 (= K46), S43 (= S47), T44 (= T48), Q82 (= Q90), R129 (≠ K135), Q133 (≠ E139), S135 (= S141), G136 (= G142), G137 (= G143), Q159 (≠ E165), H192 (= H198)
- binding magnesium ion: S43 (= S47), Q82 (= Q90)
8hprC Lpqy-sugabc in state 4 (see paper)
32% identity, 81% coverage: 6:272/330 of query aligns to 3:267/363 of 8hprC
- binding adenosine-5'-triphosphate: Y12 (= Y15), S38 (= S42), G39 (= G43), G41 (= G45), K42 (= K46), S43 (= S47), Q82 (= Q90), Q133 (≠ E139), G136 (= G142), G137 (= G143), Q138 (≠ E144), H192 (= H198)
- binding magnesium ion: S43 (= S47), Q82 (= Q90)
8hplC Lpqy-sugabc in state 1 (see paper)
31% identity, 81% coverage: 6:272/330 of query aligns to 3:265/384 of 8hplC
P9WQI3 Trehalose import ATP-binding protein SugC; MtbSugC; Nucleotide-binding domain of SugABC transporter; NBD of SugABC transporter; SugABC transporter ATPase SugC; EC 7.5.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
31% identity, 75% coverage: 22:268/330 of query aligns to 19:264/393 of P9WQI3
- H193 (= H198) mutation to A: Decreased hydrolysis of ATP. No change in KM, but 2-fold reduction in Vmax compared to wild-type.
Query Sequence
>CA265_RS15880 FitnessBrowser__Pedo557:CA265_RS15880
MSNTIISVKNLTKQYQAEQAGGIKNVSFEIKQGDVVAIIGESGSGKSTLLKSIYGLLKTD
EGEIFFEDKRVKGPDEQLIPGHKQMKMVTQDFSLNIYAKVYDNIASQLSNTDLKTKAEKT
LQIMEHLRILPLQNKKIIELSGGEQQRVAIAKAMVADTQVLLLDEPFSQVDALLKNQLRA
DIKRVASETGVTVILVSHDPADGLFLADQLLILKNGELLQTGKPSEIYQHPKHIYTAQIL
GNAVVLSQADAEKIGLKTERNSVVFYPEWAEISNSWSSRRFEVKDVYYKGFYDELLLERN
GVSIRAIQLNRGAHKKNDYVQLNISRFLAF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory