SitesBLAST
Comparing CA265_RS15950 FitnessBrowser__Pedo557:CA265_RS15950 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P23893 Glutamate-1-semialdehyde 2,1-aminomutase; GSA; Glutamate-1-semialdehyde aminotransferase; GSA-AT; EC 5.4.3.8 from Escherichia coli (strain K12) (see paper)
47% identity, 92% coverage: 30:450/456 of query aligns to 3:426/426 of P23893
- K265 (= K292) mutation to R: 2% of wild-type activity.
6w80A Crystal structure of glutamate-1-semialdehyde 2,1-aminomutase from stenotrophomonas maltophilia k279a in complex with plp
48% identity, 90% coverage: 30:440/456 of query aligns to 10:416/430 of 6w80A
- active site: V26 (= V46), Y149 (= Y169), D241 (= D264), K269 (= K292)
- binding pyridoxal-5'-phosphate: S121 (= S141), G122 (= G142), T123 (= T143), Y149 (= Y169), H150 (= H170), E208 (= E231), N213 (= N236), D241 (= D264), V243 (= V266), K269 (= K292)
3bs8A Crystal structure of glutamate 1-semialdehyde aminotransferase complexed with pyridoxamine-5'-phosphate from bacillus subtilis (see paper)
50% identity, 90% coverage: 35:445/456 of query aligns to 4:419/430 of 3bs8A
- active site: V22 (= V46), Y145 (= Y169), E207 (= E231), D240 (= D264), M243 (≠ I267), K268 (= K292), G401 (≠ V427)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G118 (= G142), T119 (= T143), Y145 (= Y169), H146 (= H170), E207 (= E231), N212 (= N236), D240 (= D264), V242 (= V266), K268 (= K292)
5i92F Crystal structure of glutamate-1-semialdehyde 2,1- aminomutase (gsa) from pseudomonas aeruginosa
48% identity, 90% coverage: 30:440/456 of query aligns to 3:408/420 of 5i92F
Sites not aligning to the query:
P42799 Glutamate-1-semialdehyde 2,1-aminomutase 1, chloroplastic; AtGSA1; GSA 1; Glutamate-1-semialdehyde aminotransferase 1; GSA-AT 1; EC 5.4.3.8 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
47% identity, 92% coverage: 23:440/456 of query aligns to 45:461/474 of P42799
- K314 (= K292) modified: N6-(pyridoxal phosphate)lysine
3fqaA Gabaculien complex of gabaculine resistant gsam version (see paper)
46% identity, 93% coverage: 29:450/456 of query aligns to 3:426/426 of 3fqaA
- active site: V20 (= V46), Y143 (= Y169), D238 (= D264), I241 (= I267), K266 (= K292), A400 (≠ V427)
- binding 3-aminobenzoic acid: S22 (= S48), R25 (= R51), W60 (= W86)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G116 (= G142), T117 (= T143), Y143 (= Y169), E205 (= E231), N210 (= N236), D238 (= D264), V240 (= V266), I241 (= I267)
5hdmB Crystal structure of arabidopsis thaliana glutamate-1-semialdehyde-2, 1-aminomutase (see paper)
47% identity, 91% coverage: 27:440/456 of query aligns to 3:415/428 of 5hdmB
- active site: V22 (= V46), Y145 (= Y169), E207 (= E231), D240 (= D264), M243 (≠ I267), K268 (= K292), A402 (≠ V427)
- binding pyridoxal-5'-phosphate: G118 (= G142), T119 (= T143), Y145 (= Y169), E207 (= E231), N212 (= N236), D240 (= D264), V242 (= V266), M243 (≠ I267), K268 (= K292)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G118 (= G142), T119 (= T143), Y145 (= Y169), E207 (= E231), N212 (= N236), D240 (= D264), V242 (= V266), M243 (≠ I267), K268 (= K292)
5hdmA Crystal structure of arabidopsis thaliana glutamate-1-semialdehyde-2, 1-aminomutase (see paper)
47% identity, 91% coverage: 27:440/456 of query aligns to 3:415/428 of 5hdmA
- active site: V22 (= V46), Y145 (= Y169), E207 (= E231), D240 (= D264), M243 (≠ I267), K268 (= K292), A402 (≠ V427)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G118 (= G142), T119 (= T143), Y145 (= Y169), G147 (= G171), E207 (= E231), N212 (= N236), D240 (= D264), V242 (= V266), K268 (= K292)
Q42522 Glutamate-1-semialdehyde 2,1-aminomutase 2, chloroplastic; GSA 2; Glutamate-1-semialdehyde aminotransferase 2; GSA-AT 2; EC 5.4.3.8 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
47% identity, 90% coverage: 30:440/456 of query aligns to 50:459/472 of Q42522
- R92 (≠ W72) mutation to K: In gsa2-1; suppression of enf1 mutant pleiotropic developmental phenotypes; when associated with S-162.
- G162 (= G142) mutation to S: In gsa2-1; suppression of enf1 mutant pleiotropic developmental phenotypes; when associated with K-92.
2gsaB Crystal structure of glutamate-1-semialdehyde aminomutase (aminotransferase, wild-type form) (see paper)
46% identity, 93% coverage: 29:450/456 of query aligns to 4:427/427 of 2gsaB
- active site: V21 (= V46), Y144 (= Y169), E206 (= E231), D239 (= D264), M242 (≠ I267), K267 (= K292), A401 (≠ V427)
- binding pyridoxal-5'-phosphate: G117 (= G142), T118 (= T143), Y144 (= Y169), E206 (= E231), N211 (= N236), D239 (= D264), V241 (= V266), M242 (≠ I267), K267 (= K292)
2gsaA Crystal structure of glutamate-1-semialdehyde aminomutase (aminotransferase, wild-type form) (see paper)
46% identity, 93% coverage: 29:450/456 of query aligns to 4:427/427 of 2gsaA
- active site: V21 (= V46), Y144 (= Y169), E206 (= E231), D239 (= D264), M242 (≠ I267), K267 (= K292), A401 (≠ V427)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G117 (= G142), T118 (= T143), Y144 (= Y169), H145 (= H170), G146 (= G171), N211 (= N236), D239 (= D264), V241 (= V266), K267 (= K292)
3usfA Crystal structure of dava-4
45% identity, 93% coverage: 29:450/456 of query aligns to 4:427/427 of 3usfA
- active site: V21 (= V46), Y144 (= Y169), D239 (= D264), M242 (≠ I267), K267 (= K292), A401 (≠ V427)
- binding (4s)-4,5-diaminopentanoic acid: S23 (= S48), V25 (= V50), S157 (= S182), K267 (= K292), E400 (= E426)
- binding (5-hydroxy-4,6-dimethylpyridin-3-yl)methyl dihydrogen phosphate: G117 (= G142), T118 (= T143), Y144 (= Y169), N211 (= N236), D239 (= D264), V241 (= V266), K267 (= K292)
3fq7A Gabaculine complex of gsam (see paper)
45% identity, 93% coverage: 29:450/456 of query aligns to 4:427/427 of 3fq7A
- active site: V21 (= V46), Y144 (= Y169), D239 (= D264), M242 (≠ I267), K267 (= K292), A401 (≠ V427)
- binding 3-[o-phosphonopyridoxyl]--amino-benzoic acid: S23 (= S48), V25 (= V50), W61 (= W86), G117 (= G142), T118 (= T143), Y144 (= Y169), H145 (= H170), E206 (= E231), N211 (= N236), D239 (= D264), V241 (= V266), M242 (≠ I267), K267 (= K292), G298 (= G323), T299 (= T324), E400 (= E426)
2hp2A Inter-subunit signaling in gsam (see paper)
45% identity, 93% coverage: 29:450/456 of query aligns to 4:427/427 of 2hp2A
- active site: V21 (= V46), Y144 (= Y169), D239 (= D264), M242 (≠ I267), K267 (= K292), A401 (≠ V427)
- binding (4s)-4,5-diaminopentanoic acid: G298 (= G323), T299 (= T324)
- binding (4r)-5-amino-4-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]pentanoic acid: S23 (= S48), G117 (= G142), T118 (= T143), Y144 (= Y169), H145 (= H170), E206 (= E231), N211 (= N236), D239 (= D264), V241 (= V266), M242 (≠ I267), K267 (= K292)
- binding pyridoxal-5'-phosphate: G298 (= G323), T299 (= T324)
2hp1A Inter-subunit signaling in gsam (see paper)
45% identity, 93% coverage: 29:450/456 of query aligns to 4:427/427 of 2hp1A
- active site: V21 (= V46), Y144 (= Y169), D239 (= D264), M242 (≠ I267), K267 (= K292), A401 (≠ V427)
- binding (4s)-4-amino-5-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]pentanoic acid: S23 (= S48), V25 (= V50), W61 (= W86), S116 (= S141), G117 (= G142), T118 (= T143), Y144 (= Y169), H145 (= H170), G146 (= G171), E206 (= E231), N211 (= N236), D239 (= D264), V241 (= V266), M242 (≠ I267), K267 (= K292), E400 (= E426)
2hozA Inter-subunit signaling in gsam (see paper)
45% identity, 93% coverage: 29:450/456 of query aligns to 4:427/427 of 2hozA
- active site: V21 (= V46), Y144 (= Y169), D239 (= D264), M242 (≠ I267), K267 (= K292), A401 (≠ V427)
- binding (4s)-4,5-diaminopentanoic acid: E141 (= E166), G156 (= G181), S157 (= S182), P182 (= P207), N368 (≠ S394), E370 (≠ D396), K373 (≠ D399)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G117 (= G142), T118 (= T143), Y144 (= Y169), H145 (= H170), G146 (= G171), E206 (= E231), N211 (= N236), D239 (= D264), G298 (= G323), T299 (= T324)
3k28A Crystal structure of a glutamate-1-semialdehyde aminotransferase from bacillus anthracis with bound pyridoxal 5'phosphate
48% identity, 89% coverage: 30:435/456 of query aligns to 6:404/423 of 3k28A
- active site: V22 (= V46), Y145 (= Y169), E202 (= E231), D235 (= D264), M238 (≠ I267), K263 (= K292), G396 (≠ V427)
- binding calcium ion: I103 (= I127), V106 (≠ N130), P107 (≠ R131), I109 (≠ V133)
- binding pyridoxal-5'-phosphate: G118 (= G142), T119 (= T143), Y145 (= Y169), H146 (= H170), G147 (= G171), E202 (= E231), D235 (= D264), V237 (= V266), M238 (≠ I267), K263 (= K292)
2e7uA Crystal structure of glutamate-1-semialdehyde 2,1-aminomutase from thermus thermophilus hb8
45% identity, 93% coverage: 26:450/456 of query aligns to 1:424/424 of 2e7uA
- active site: V21 (= V46), Y144 (= Y169), E206 (= E231), D238 (= D264), M241 (≠ I267), K266 (= K292), A401 (≠ V427)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G117 (= G142), T118 (= T143), Y144 (= Y169), H145 (= H170), N211 (= N236), D238 (= D264), V240 (= V266)
3usfB Crystal structure of dava-4
42% identity, 93% coverage: 29:450/456 of query aligns to 4:402/402 of 3usfB
- active site: V21 (= V46), Y144 (= Y169), E181 (= E231), D214 (= D264), M217 (≠ I267), K242 (= K292), A376 (≠ V427)
- binding (4s)-4,5-diaminopentanoic acid: G273 (= G323), T274 (= T324)
- binding (5-hydroxy-4,6-dimethylpyridin-3-yl)methyl dihydrogen phosphate: G117 (= G142), T118 (= T143), Y144 (= Y169), E181 (= E231), N186 (= N236), D214 (= D264), V216 (= V266), M217 (≠ I267), K242 (= K292)
2hp1B Inter-subunit signaling in gsam (see paper)
42% identity, 93% coverage: 29:450/456 of query aligns to 4:398/398 of 2hp1B
- active site: V21 (= V46), Y144 (= Y169), E177 (= E231), D210 (= D264), M213 (≠ I267), K238 (= K292), A372 (≠ V427)
- binding (4s)-4-amino-5-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]pentanoic acid: G269 (= G323), T270 (= T324)
- binding (4s)-4,5-diaminopentanoic acid: S23 (= S48), V25 (= V50), R26 (= R51), W61 (= W86), Y144 (= Y169)
- binding pyridoxal-5'-phosphate: S116 (= S141), G117 (= G142), T118 (= T143), Y144 (= Y169), E177 (= E231), N182 (= N236), D210 (= D264), V212 (= V266), M213 (≠ I267), K238 (= K292)
Query Sequence
>CA265_RS15950 FitnessBrowser__Pedo557:CA265_RS15950
MLDSLKKMFSGNEADIPVNTGSKPDISRVKSAELYEKSKTYFPGGVNSPVRAFKSVYGTP
LFIEKGDGCYIWDADGNQFIDFCGSWGPLILGHNNPKIREKVTEVMQNGMSFGAPTALEN
ELAELIIKNNRFVEKIRFTSSGTEAVMSAIRLARGFTSRDKILKFEGCYHGHSDSLLVKA
GSGLVTFGETSSAGVPKSFAEETIVVPLNDKTAIEQAFAQFKDQIAAVIIEGIPANNGLI
IQDEEYIHFLRKICTDNGSLLIFDEVITGFRVGFEGAAAHYGVTPDIVTYGKIIGGGLPV
GMYGARAEIMAHISPDGGVYQAGTLSGNPVAMAAGIATLTELNKSSFYKDLNTKAQEFVA
SIQRFATARNYKFKVFTIGSIFWFAFTDKDKIQSADDIDAGSMEKFKIMHRELLNRGIYL
GPSGYEVGFVSSAHTKIELEKAKRAIFEALDLVFKK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory