Comparing CA265_RS16020 FitnessBrowser__Pedo557:CA265_RS16020 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7d0aB Acinetobacter mlafedb complex in adp-vanadate trapped vclose conformation (see paper)
39% identity, 98% coverage: 1:244/250 of query aligns to 4:237/263 of 7d0aB
7d08B Acinetobacter mlafedb complex in atp-bound vtrans1 conformation (see paper)
39% identity, 98% coverage: 1:244/250 of query aligns to 4:237/263 of 7d08B
6z5uK Cryo-em structure of the a. Baumannii mlabdef complex bound to appnhp (see paper)
39% identity, 98% coverage: 1:244/250 of query aligns to 2:235/253 of 6z5uK
Q9AT00 Protein TRIGALACTOSYLDIACYLGLYCEROL 3, chloroplastic; ABC transporter I family member 13; ABC transporter ABCI.13; AtABCI13; Non-intrinsic ABC protein 11; AtNAP11 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
39% identity, 90% coverage: 1:224/250 of query aligns to 84:322/345 of Q9AT00
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
35% identity, 99% coverage: 1:248/250 of query aligns to 1:252/343 of P30750
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
34% identity, 99% coverage: 1:248/250 of query aligns to 2:253/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
34% identity, 99% coverage: 1:248/250 of query aligns to 2:253/344 of 3tuiC
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
34% identity, 99% coverage: 1:248/250 of query aligns to 2:253/344 of 6cvlD
7chaI Cryo-em structure of p.Aeruginosa mlafebd with amppnp (see paper)
34% identity, 94% coverage: 2:237/250 of query aligns to 4:239/262 of 7chaI
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
37% identity, 90% coverage: 1:225/250 of query aligns to 1:223/240 of 4ymuJ
3c4jA Abc protein artp in complex with atp-gamma-s
36% identity, 90% coverage: 1:225/250 of query aligns to 3:225/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
36% identity, 90% coverage: 1:225/250 of query aligns to 3:225/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
36% identity, 90% coverage: 1:225/250 of query aligns to 3:225/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
36% identity, 90% coverage: 1:225/250 of query aligns to 3:225/242 of 2oljA
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
35% identity, 97% coverage: 1:243/250 of query aligns to 2:240/241 of 4u00A
6xgyA Crystal structure of e. Coli mlafb abc transport subunits in the dimeric state (see paper)
35% identity, 95% coverage: 1:237/250 of query aligns to 4:240/264 of 6xgyA
7ch6C Cryo-em structure of e.Coli mlafeb with amppnp (see paper)
35% identity, 95% coverage: 1:237/250 of query aligns to 4:240/265 of 7ch6C
7cgnB The overall structure of the mlafedb complex in atp-bound eqtall conformation (mutation of e170q on mlaf) (see paper)
35% identity, 95% coverage: 1:237/250 of query aligns to 4:240/263 of 7cgnB
7ch8I Cryo-em structure of p.Aeruginosa mlafebd with adp-v (see paper)
36% identity, 82% coverage: 33:237/250 of query aligns to 34:236/259 of 7ch8I
Sites not aligning to the query:
8i6rB Cryo-em structure of pseudomonas aeruginosa ftse(e163q)x/envc complex with atp in peptidisc (see paper)
34% identity, 86% coverage: 1:215/250 of query aligns to 1:214/222 of 8i6rB
>CA265_RS16020 FitnessBrowser__Pedo557:CA265_RS16020
MIEIKDIYKSFSGNDVLQGISGKFEEGVTNLIIGGSGSGKTTLLKCMVGLHQPDSGSVLY
DGRDFTPMTYEQRIEVRKEIGMLFQGSALFDSMTVEENIMFPLNMFTDQSRKEKLERVDF
CLERVNLAGKNKLFPAELSGGMKKRVGIARAISMNPKYLFCDEPNSGLDPKTSIVIDELI
QEITEEYKTTTIVVTHDMNSVMGIGDYILFLHEGKKFWEGSNKEIAHTDIKELNDFVFAS
RFMKAAKDKF
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory