SitesBLAST
Comparing CA265_RS16425 FitnessBrowser__Pedo557:CA265_RS16425 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6z1mA Structure of an ancestral glycosidase (family 1) bound to heme (see paper)
43% identity, 99% coverage: 7:445/445 of query aligns to 3:420/423 of 6z1mA
- binding protoporphyrin ix containing fe: P164 (= P168), N165 (≠ F169), L194 (≠ T198), L195 (≠ A199), L218 (≠ F222), L220 (≠ C224), N244 (= N248), F247 (= F251), K253 (≠ P261), Y256 (≠ N264), L288 (≠ F288), R318 (≠ Q342), Y323 (≠ P347)
- binding magnesium ion: H346 (≠ E371), K409 (≠ D434)
5ns8A Crystal structure of beta-glucosidase bglm-g1 mutant h75r from marine metagenome in complex with inhibitor 1-deoxynojirimycin (see paper)
41% identity, 98% coverage: 7:444/445 of query aligns to 5:438/440 of 5ns8A
2jalB Beta-glucosidase from thermotoga maritima in complex with cyclophellitol (see paper)
40% identity, 100% coverage: 3:445/445 of query aligns to 1:440/444 of 2jalB
- active site: R76 (= R78), H120 (= H122), E165 (= E167), V168 (≠ G170), N292 (≠ Q294), Y294 (= Y296), E350 (= E356)
- binding calcium ion: D277 (≠ F286), E281 (vs. gap)
- binding (1r,2s,3s,4s,5r,6r)-6-(hydroxymethyl)cyclohexane-1,2,3,4,5-pentol: Q19 (= Q21), H120 (= H122), E165 (= E167), E350 (= E356), W397 (= W402), E404 (= E409), W405 (= W410), F413 (= F418)
1w3jA Family 1 b-glucosidase from thermotoga maritima in complex with tetrahydrooxazine (see paper)
40% identity, 99% coverage: 7:445/445 of query aligns to 3:438/443 of 1w3jA
- active site: R74 (= R78), H118 (= H122), E163 (= E167), V166 (≠ G170), N290 (≠ Q294), Y292 (= Y296), E348 (= E356)
- binding tetrahydrooxazine: Q17 (= Q21), H118 (= H122), E163 (= E167), Y292 (= Y296), E348 (= E356), W395 (= W402), E402 (= E409), W403 (= W410)
1oifA Family 1 b-glucosidase from thermotoga maritima (see paper)
40% identity, 99% coverage: 7:445/445 of query aligns to 4:439/444 of 1oifA
- active site: R75 (= R78), H119 (= H122), E164 (= E167), V167 (≠ G170), N291 (≠ Q294), Y293 (= Y296), E349 (= E356)
- binding 5-hydroxymethyl-3,4-dihydroxypiperidine: Q18 (= Q21), E164 (= E167), Y293 (= Y296), E349 (= E356), W396 (= W402), E403 (= E409), W404 (= W410), F412 (= F418)
5ossB Beta-glucosidase from thermotoga maritima in complex with gluco-1h- imidazole (see paper)
40% identity, 99% coverage: 7:445/445 of query aligns to 4:439/443 of 5ossB
- active site: R75 (= R78), H119 (= H122), E164 (= E167), V167 (≠ G170), N291 (≠ Q294), Y293 (= Y296), E349 (= E356)
- binding (4~{S},5~{S},6~{R},7~{R})-7-(hydroxymethyl)-4,5,6,7-tetrahydro-1~{H}-benzimidazole-4,5,6-triol: Q18 (= Q21), H119 (= H122), E164 (= E167), Y293 (= Y296), E349 (= E356), W396 (= W402), E403 (= E409), W404 (= W410), F412 (= F418)
5n6tA Thermotoga maritima family 1 glycoside hydrolase complexed with a cyclophellitol analogue transition state mimic (see paper)
40% identity, 99% coverage: 7:445/445 of query aligns to 4:439/443 of 5n6tA
- active site: R75 (= R78), H119 (= H122), E164 (= E167), V167 (≠ G170), N291 (≠ Q294), Y293 (= Y296), E349 (= E356)
- binding [(1~{R},2~{R},3~{R},4~{S},5~{R},6~{S})-3,4,5-tris(oxidanyl)-7-oxabicyclo[4.1.0]heptan-2-yl]methanediazonium: Q18 (= Q21), H119 (= H122), N163 (= N166), E164 (= E167), Y293 (= Y296), E349 (= E356), W396 (= W402), E403 (= E409), W404 (= W410), F412 (= F418)
5n6sA Thermotoga maritima family 1 glycoside hydrolase complexed with carba- cyclophellitol transition state mimic (see paper)
40% identity, 99% coverage: 7:445/445 of query aligns to 4:439/443 of 5n6sA
- active site: R75 (= R78), H119 (= H122), E164 (= E167), V167 (≠ G170), N291 (≠ Q294), Y293 (= Y296), E349 (= E356)
- binding azanylidene-[4-[[(1~{S},2~{R},3~{R},4~{R},5~{S},6~{S},7~{S})-2-(hydroxymethyl)-3,4,5-tris(oxidanyl)-7-bicyclo[4.1.0]heptanyl]carbonylamino]butylimino]azanium: Q18 (= Q21), H119 (= H122), W120 (= W123), N163 (= N166), E164 (= E167), W166 (≠ F169), V167 (≠ G170), E349 (= E356), W396 (= W402), E403 (= E409), W404 (= W410), F412 (= F418)
2wc4A Structure of family 1 beta-glucosidase from thermotoga maritima in complex with 3-imino-2-thia-(+)-castanospermine (see paper)
40% identity, 99% coverage: 7:445/445 of query aligns to 4:439/443 of 2wc4A
- active site: R75 (= R78), H119 (= H122), E164 (= E167), V167 (≠ G170), N291 (≠ Q294), Y293 (= Y296), E349 (= E356)
- binding (3Z,5S,6R,7S,8R,8aS)-3-(octylimino)hexahydro[1,3]thiazolo[3,4-a]pyridine-5,6,7,8-tetrol: Q18 (= Q21), H119 (= H122), N163 (= N166), E164 (= E167), Y293 (= Y296), W322 (= W329), E349 (= E356), W396 (= W402), E403 (= E409), W404 (= W410), F412 (= F418)
2wbgA Structure of family 1 beta-glucosidase from thermotoga maritima in complex with 3-imino-2-oxa-(+)-castanospermine (see paper)
40% identity, 99% coverage: 7:445/445 of query aligns to 4:439/443 of 2wbgA
- active site: R75 (= R78), H119 (= H122), E164 (= E167), V167 (≠ G170), N291 (≠ Q294), Y293 (= Y296), E349 (= E356)
- binding (3Z,5S,6R,7S,8R,8aR)-3-(octylimino)hexahydro[1,3]oxazolo[3,4-a]pyridine-5,6,7,8-tetrol: Q18 (= Q21), H119 (= H122), N163 (= N166), E164 (= E167), Y293 (= Y296), H296 (≠ L299), W322 (= W329), E349 (= E356), W396 (= W402), E403 (= E409), W404 (= W410)
2j78A Beta-glucosidase from thermotoga maritima in complex with gluco- hydroximolactam (see paper)
40% identity, 99% coverage: 7:445/445 of query aligns to 4:438/443 of 2j78A
- active site: R75 (= R78), H119 (= H122), E164 (= E167), V167 (≠ G170), N291 (≠ Q294), Y293 (= Y296), E348 (= E356)
- binding calcium ion: E64 (≠ A67), E67 (≠ K70), D276 (≠ F286), S279 (vs. gap)
- binding (2s,3s,4r,5r)-6-(hydroxyamino)-2-(hydroxymethyl)-2,3,4,5-tetrahydropyridine-3,4,5-triol: Q18 (= Q21), H119 (= H122), N163 (= N166), E164 (= E167), Y293 (= Y296), E348 (= E356), W395 (= W402), E402 (= E409), W403 (= W410), F411 (= F418)
1oinA Family 1 b-glucosidase from thermotoga maritima (see paper)
40% identity, 100% coverage: 3:445/445 of query aligns to 1:438/442 of 1oinA
- active site: R76 (= R78), H120 (= H122), E165 (= E167), V168 (≠ G170), N292 (≠ Q294), Y294 (= Y296), E348 (= E356)
- binding 2-deoxy-2-fluoro-alpha-D-glucopyranose: Q19 (= Q21), H120 (= H122), N164 (= N166), E165 (= E167), Y294 (= Y296), E348 (= E356), W395 (= W402), E402 (= E409), W403 (= W410)
2wc3A Structure of family 1 beta-glucosidase from thermotoga maritima in complex with 3-imino-2-oxa-(+)-8-epi-castanospermine (see paper)
40% identity, 100% coverage: 3:445/445 of query aligns to 1:438/442 of 2wc3A
- active site: R76 (= R78), H120 (= H122), E165 (= E167), V168 (≠ G170), N292 (≠ Q294), Y294 (= Y296), E348 (= E356)
- binding (3Z,5S,6R,7S,8S,8aR)-3-(octylimino)hexahydro[1,3]oxazolo[3,4-a]pyridine-5,6,7,8-tetrol: Q19 (= Q21), H120 (= H122), N164 (= N166), E165 (= E167), Y294 (= Y296), H297 (≠ L299), W321 (= W329), E348 (= E356), W395 (= W402), E402 (= E409), W403 (= W410), F411 (= F418)
2cesA Beta-glucosidase from thermotoga maritima in complex with glucoimidazole (see paper)
40% identity, 99% coverage: 7:445/445 of query aligns to 4:436/440 of 2cesA
- active site: R75 (= R78), H119 (= H122), E164 (= E167), V167 (≠ G170), N291 (≠ Q294), Y293 (= Y296), E346 (= E356)
- binding glucoimidazole: Q18 (= Q21), H119 (= H122), N163 (= N166), E164 (= E167), Y293 (= Y296), E346 (= E356), W393 (= W402), E400 (= E409), W401 (= W410), F409 (= F418)
2cbvA Beta-glucosidase from thermotoga maritima in complex with calystegine b2 (see paper)
40% identity, 99% coverage: 7:445/445 of query aligns to 4:438/443 of 2cbvA
- active site: R75 (= R78), H119 (= H122), E164 (= E167), V167 (≠ G170), N290 (≠ Q294), Y292 (= Y296), E348 (= E356)
- binding calystegine b2: Q18 (= Q21), H119 (= H122), W120 (= W123), N163 (= N166), E164 (= E167), E348 (= E356), W395 (= W402), E402 (= E409), W403 (= W410)
1oimA Family 1 b-glucosidase from thermotoga maritima (see paper)
40% identity, 99% coverage: 7:445/445 of query aligns to 4:438/443 of 1oimA
- active site: R75 (= R78), H119 (= H122), E164 (= E167), V167 (≠ G170), N290 (≠ Q294), Y292 (= Y296), E348 (= E356)
- binding 1-deoxynojirimycin: Q18 (= Q21), H119 (= H122), N163 (= N166), E164 (= E167), Y292 (= Y296), E348 (= E356), W395 (= W402), E402 (= E409), W403 (= W410)
2j75A Beta-glucosidase from thermotoga maritima in complex with noeuromycin (see paper)
40% identity, 99% coverage: 7:445/445 of query aligns to 4:434/438 of 2j75A
- active site: R75 (= R78), H119 (= H122), E164 (= E167), V167 (≠ G170), N288 (≠ Q294), Y290 (= Y296), E344 (= E356)
- binding (2r,3s,4r,5r)-5-(hydroxymethyl)piperidine-2,3,4-triol: Q18 (= Q21), H119 (= H122), N163 (= N166), E164 (= E167), Y290 (= Y296), E344 (= E356), W391 (= W402), E398 (= E409), W399 (= W410), F407 (= F418)
1uz1A Family 1 b-glucosidase from thermotoga maritima in complex with isofagomine lactam (see paper)
40% identity, 99% coverage: 7:445/445 of query aligns to 4:435/439 of 1uz1A
- active site: R75 (= R78), H119 (= H122), E164 (= E167), V167 (≠ G170), N290 (≠ Q294), Y292 (= Y296), E345 (= E356)
- binding (3s,4r,5r)-3,4-dihydroxy-5-(hydroxymethyl)piperidin-2-one: Q18 (= Q21), H119 (= H122), N163 (= N166), E164 (= E167), Y292 (= Y296), E345 (= E356), W392 (= W402), E399 (= E409), W400 (= W410), F408 (= F418)
2cbuA Beta-glucosidase from thermotoga maritima in complex with castanospermine (see paper)
40% identity, 99% coverage: 7:445/445 of query aligns to 4:435/440 of 2cbuA
- active site: R75 (= R78), H119 (= H122), E164 (= E167), V167 (≠ G170), N289 (≠ Q294), Y291 (= Y296), E345 (= E356)
- binding castanospermine: Q18 (= Q21), H119 (= H122), N163 (= N166), E164 (= E167), Y291 (= Y296), W318 (= W329), E345 (= E356), W392 (= W402), E399 (= E409), W400 (= W410), F408 (= F418)
2j7hA Beta-glucosidase from thermotoga maritima in complex with azafagomine (see paper)
40% identity, 99% coverage: 7:445/445 of query aligns to 4:434/438 of 2j7hA
- active site: R75 (= R78), H119 (= H122), E164 (= E167), V167 (≠ G170), N287 (≠ Q294), Y289 (= Y296), E344 (= E356)
- binding azafagomine: Q18 (= Q21), H119 (= H122), E164 (= E167), Y289 (= Y296), E344 (= E356), W391 (= W402), E398 (= E409), W399 (= W410), F407 (= F418)
- binding calcium ion: H38 (≠ A41), D50 (= D53)
Query Sequence
>CA265_RS16425 FitnessBrowser__Pedo557:CA265_RS16425
MINASDFGQNFLWGVATAAAQIEGTATQYGKGPSIWDTFTAKNGKIKKNHKLDPACDFYH
RYAEDLALVKLLGFKVFRFSIAWSRILPAGRGEINQEGIRFYHNLIDECLTQGITPYVTL
YHWDLPQALEDEGGWTSFSINAAFNAFVSICAIEYGDKVKNWIVLNEPFGYTSLGYMLGV
HAPGKTGLGNFFSAVLHTALAQADGGKILRAEISKANIGTTFSCSEIIPSTQSDSDVLVA
RRVDCLMNRLFVEPTQGMGFPTANWDALEKFQIEYGTWRLHERMKFDFDFIGLQNYFPLV
VKYNAFIPVIQAWEVKAKSRKKPHTAMGWEVNADSFYNIVKQFAAYPNIKNILITENGAA
YHDKLINGKVEDPERIEYFKLYLKALLKLKKEGINVTGYMAWTLMDNFEWAEGFTARFGL
IYNDFKTQERSIKDSGYWWQNFLKS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory