SitesBLAST
Comparing CA265_RS16770 FitnessBrowser__Pedo557:CA265_RS16770 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 14 hits to proteins with known functional sites (download)
7w2jD Cryo-em structure of membrane-bound fructose dehydrogenase from gluconobacter japonicus
25% identity, 97% coverage: 14:574/578 of query aligns to 4:537/537 of 7w2jD
- binding fe3-s4 cluster: R200 (≠ N210), C211 (= C215), G213 (≠ Y217), N214 (≠ C218), N215 (≠ G219), C217 (= C221), C221 (= C225), I223 (≠ V227), A225 (≠ G229), S338 (= S351)
- binding flavin-adenine dinucleotide: G9 (= G19), G11 (= G21), D32 (≠ E42), A33 (= A43), Y59 (≠ F76), K97 (≠ R104), G101 (= G108), T102 (≠ R109), T103 (= T110), H105 (= H112), W106 (= W113), S109 (≠ I116), V249 (= V255), A284 (= A291), N285 (≠ S292), E288 (= E295), K291 (≠ R298), L292 (≠ I299), N472 (≠ P505), N516 (= N553), S517 (≠ A554), T518 (= T555)
- binding heme c: P209 (vs. gap), I223 (≠ V227)
8jejA Cryo-em structure of na-dithionite reduced membrane-bound fructose dehydrogenase from gluconobacter japonicus
25% identity, 97% coverage: 14:574/578 of query aligns to 7:540/540 of 8jejA
- binding fe3-s4 cluster: R203 (≠ N210), C214 (= C215), C215 (≠ F216), G216 (≠ Y217), N217 (≠ C218), N218 (≠ G219), N219 (≠ Q220), C220 (= C221), C224 (= C225), I226 (≠ V227), M229 (≠ D230), S341 (= S351)
- binding flavin-adenine dinucleotide: I11 (≠ V18), G12 (= G19), G14 (= G21), I15 (≠ A22), C16 (≠ G23), D35 (≠ E42), A36 (= A43), G97 (≠ F101), K100 (≠ R104), G101 (≠ M105), G104 (= G108), T105 (≠ R109), T106 (= T110), H108 (= H112), W109 (= W113), A110 (≠ G114), S112 (≠ I116), M221 (≠ G222), A250 (= A253), V252 (= V255), A287 (= A291), N288 (≠ S292), E291 (= E295), N475 (≠ K507), H476 (= H510), N519 (= N553), T521 (= T555), M524 (≠ I558)
8grjB Crystal structure of gamma-alpha subunit complex from burkholderia cepacia fad glucose dehydrogenase in complex with gluconolactone
25% identity, 94% coverage: 26:569/578 of query aligns to 14:527/531 of 8grjB
- binding fe3-s4 cluster: C204 (= C215), C205 (≠ F216), G206 (≠ Y217), N207 (≠ C218), N209 (≠ Q220), C210 (= C221), C214 (= C225), P331 (≠ V390)
- binding flavin-adenine dinucleotide: E30 (= E42), A31 (= A43), Q86 (≠ F101), R89 (= R104), T94 (≠ R109), H97 (= H112), W98 (= W113), A99 (≠ G114), S101 (≠ I116), M211 (≠ G222), V242 (= V255), A277 (= A291), N278 (≠ S292), E281 (= E295), I285 (= I299), N467 (= N499), N511 (= N553), T513 (= T555)
- binding D-glucono-1,5-lactone: M211 (≠ G222), E333 (≠ Q392), H355 (vs. gap), N466 (≠ T498), N467 (= N499), H468 (= H510), N511 (= N553)
Sites not aligning to the query:
7qf8A Crystal structure of a bacterial pyranose 2-oxidase from pseudoarthrobacter siccitolerans (see paper)
22% identity, 97% coverage: 8:569/578 of query aligns to 1:483/494 of 7qf8A
- binding flavin-adenine dinucleotide: V11 (= V18), G12 (= G19), G14 (= G21), P15 (≠ A22), T16 (≠ G23), E37 (= E42), V38 (≠ A43), S114 (≠ R102), G119 (= G108), M120 (≠ R109), W124 (= W113), T125 (≠ G114), A127 (≠ I116), V227 (≠ I250), G261 (= G290), A262 (= A291), D263 (≠ S292), R266 (≠ E295), P331 (vs. gap), L422 (≠ I509), H423 (= H510), N467 (= N553), T469 (= T555)
4mifB Pyranose 2-oxidase from phanerochaete chrysosporium, wild type from natural source (see paper)
21% identity, 58% coverage: 237:572/578 of query aligns to 253:579/581 of 4mifB
Sites not aligning to the query:
- binding dihydroflavine-adenine dinucleotide: 10, 11, 12, 31, 32, 138, 142, 143, 146, 147, 148, 149, 150
4mihA Pyranose 2-oxidase from phanerochaete chrysosporium, recombinant h158a mutant (see paper)
22% identity, 58% coverage: 237:572/578 of query aligns to 252:574/576 of 4mihA
- binding flavin-adenine dinucleotide: C270 (≠ V255), C310 (≠ A291), A314 (≠ E295), N555 (= N553), P556 (≠ A554), T557 (= T555)
- binding 3-deoxy-3-fluoro-beta-D-glucopyranose: Q413 (≠ G402), D417 (≠ E406), Y421 (= Y410), A510 (≠ I508), H512 (= H510), N555 (= N553)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 22, 23, 24, 43, 44, 136, 137, 138, 141, 142, 146, 147, 149
4migA Pyranose 2-oxidase from phanerochaete chrysosporium, recombinant wild type (see paper)
21% identity, 58% coverage: 237:572/578 of query aligns to 244:568/570 of 4migA
- binding dihydroflavine-adenine dinucleotide: C262 (≠ V255), C302 (≠ A291), A306 (≠ E295), L505 (≠ I509), N549 (= N553), T551 (= T555)
- binding 3-deoxy-3-fluoro-beta-D-glucopyranose: Q407 (≠ S413), D411 (= D417), Y415 (≠ F421), A504 (≠ I508), H506 (= H510), N549 (= N553)
Sites not aligning to the query:
- binding dihydroflavine-adenine dinucleotide: 10, 11, 12, 31, 32, 128, 129, 130, 133, 134, 137, 138, 139, 141
- binding 3-deoxy-3-fluoro-beta-D-glucopyranose: 139
7qvaA Crystal structure of a bacterial pyranose 2-oxidase in complex with mangiferin (see paper)
25% identity, 28% coverage: 406:569/578 of query aligns to 291:448/457 of 7qvaA
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 11, 12, 14, 15, 16, 36, 37, 38, 97, 102, 103, 106, 107, 108, 110, 206, 207, 241, 242, 243, 246
- binding Mangiferin: 51, 73, 108
7qfdA Crystal structure of a bacterial pyranose 2-oxidase complex with d- glucose (see paper)
28% identity, 23% coverage: 435:569/578 of query aligns to 322:449/458 of 7qfdA
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 11, 14, 15, 16, 36, 37, 38, 101, 106, 107, 111, 112, 114, 210, 211, 246, 250
- binding alpha-D-glucopyranose: 77, 112
P79076 Pyranose 2-oxidase; P2Ox; POD; POx; PROD; Pyranose oxidase; FAD-oxidoreductase; Glucose 2-oxidase; Pyranose:oxygen 2-oxidoreductase; EC 1.1.3.10 from Trametes versicolor (White-rot fungus) (Coriolus versicolor) (see paper)
22% identity, 50% coverage: 280:569/578 of query aligns to 309:609/623 of P79076
- E542 (≠ N504) mutation to K: Increases thermostability up to 65 degrees Celsius and enhances pH stability in alkaline solution. Increases the catalytic efficiency 2-fold for D-glucose and 3-fold for 1,5-anhydro-D-glucitol, mainly by lowering the Km values for these two substrates to 0.74 mM and 14.3 mM, respectively.
Sites not aligning to the query:
- 28:38 modified: propeptide
4mofA Pyranose 2-oxidase h450g mutant with 2-fluorinated glucose (see paper)
26% identity, 25% coverage: 432:578/578 of query aligns to 430:568/573 of 4mofA
Sites not aligning to the query:
- binding dihydroflavine-adenine dinucleotide: 7, 10, 11, 12, 31, 32, 113, 114, 118, 119, 122, 123, 124, 126, 238, 275, 279, 409
- binding 2-deoxy-2-fluoro-alpha-D-glucopyranose: 124, 403, 407, 411, 429
4mooA Pyranose 2-oxidase h450g mutant with 2-fluorinated galactose (see paper)
26% identity, 25% coverage: 432:578/578 of query aligns to 433:571/576 of 4mooA
Sites not aligning to the query:
- binding dihydroflavine-adenine dinucleotide: 10, 13, 14, 15, 34, 35, 116, 121, 122, 125, 126, 127, 128, 129, 241, 278, 282
- binding 2-deoxy-2-fluoro-alpha-D-galactopyranose: 127, 406, 410, 412, 414, 432
4momA Pyranose 2-oxidase h450g mutant with 3-fluorinated galactose (see paper)
26% identity, 25% coverage: 432:578/578 of query aligns to 433:571/576 of 4momA
Sites not aligning to the query:
- binding 3-deoxy-3-fluoro-beta-D-galactopyranose: 127, 406, 410, 414, 432
- binding dihydroflavine-adenine dinucleotide: 10, 13, 14, 15, 34, 35, 116, 121, 122, 125, 126, 127, 129, 241, 278
4moeA Pyranose 2-oxidase h450g mutant with 3-fluorinated glucose (see paper)
26% identity, 25% coverage: 432:578/578 of query aligns to 433:571/576 of 4moeA
Sites not aligning to the query:
- binding dihydroflavine-adenine dinucleotide: 10, 13, 14, 15, 34, 35, 117, 121, 122, 125, 126, 127, 128, 129, 241, 278
- binding 3-deoxy-3-fluoro-beta-D-glucopyranose: 127, 406, 410, 412, 414
Query Sequence
>CA265_RS16770 FitnessBrowser__Pedo557:CA265_RS16770
MSDFQIKKSPTVYDAIIVGSGAGGGMAAYVLAHAGQKVLLLEAGQNFDPRLDSHQLKWPW
ESPRRGASTTRPFGDFDASYGGWELEGEPYTQKNKSEFEWFRSRMLGGRTNHWGRISLRM
GPEDFKPKDGLTDAWPITYADVKPFYDKVDRMIGIYGTAEGLENEPDGIFMKPPKPRLNE
LFIKKGAEKAGVKVITGRGSVLTEALPNNNDRAPCFYCGQCGRSCKVYGDFSSSSCLVNP
AVKTGNLTVITDAMVREVITDKDGSAKGVSYVNRKDLQEYQVNGKLVILGASACESARIL
LNSKSTSHPNGLANSSGVVGKYLHDSTGASVSGFLPQLMDRKRYNEDGLGSVHIYSPWWL
DNRKLNFPRGYHIEYWGGMGMPAYGFGGGVAQMNGMVPGRDGKMKEAGGYGKSLKDDYRR
FYGTGVGMAGRGTAIAREDNYCEIDPNTVDKYGIPVLRFNYKWAKDEILQAKHMQETFLS
IMKEMGAVVTSEIQGADTNYGLLNPGKIIHEVGTIRMGDDPKKSALNKYCQAHDCKNLFV
VDAGPFVQQGDKNATWTILALSMRTAEYILAQKKKQNI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory