SitesBLAST
Comparing CA265_RS17230 FitnessBrowser__Pedo557:CA265_RS17230 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5aovA Ternary crystal structure of pyrococcus furiosus glyoxylate hydroxypyruvate reductase in presence of glyoxylate (see paper)
41% identity, 98% coverage: 2:315/319 of query aligns to 4:318/334 of 5aovA
- active site: L100 (= L99), R241 (= R237), D265 (= D261), E270 (= E266), H288 (= H285)
- binding glyoxylic acid: M52 (≠ V51), L53 (≠ G52), L53 (≠ G52), Y74 (≠ H73), A75 (≠ S74), V76 (= V75), G77 (= G76), R241 (= R237), H288 (= H285)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V76 (= V75), T104 (= T103), F158 (≠ L153), G159 (= G154), R160 (≠ K155), I161 (= I156), S180 (≠ N176), R181 (= R177), A211 (≠ H207), V212 (≠ T208), P213 (≠ A209), T218 (= T214), I239 (≠ T235), A240 (= A236), R241 (= R237), H288 (= H285), G290 (= G287)
2gcgA Ternary crystal structure of human glyoxylate reductase/hydroxypyruvate reductase (see paper)
37% identity, 100% coverage: 1:318/319 of query aligns to 3:322/324 of 2gcgA
- active site: L103 (= L99), R241 (= R237), D265 (= D261), E270 (= E266), H289 (= H285)
- binding (2r)-2,3-dihydroxypropanoic acid: L55 (≠ G52), S78 (= S74), V79 (= V75), G80 (= G76), R241 (= R237), H289 (= H285)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: V79 (= V75), T107 (= T103), G156 (= G152), G158 (= G154), I160 (= I156), G180 (≠ N176), R181 (= R177), R184 (≠ N180), C212 (≠ T208), S213 (≠ A209), T218 (= T214), I239 (≠ T235), R241 (= R237), D265 (= D261), H289 (= H285), G291 (= G287)
Q9UBQ7 Glyoxylate reductase/hydroxypyruvate reductase; EC 1.1.1.79; EC 1.1.1.81 from Homo sapiens (Human) (see paper)
37% identity, 100% coverage: 1:318/319 of query aligns to 7:326/328 of Q9UBQ7
6biiA Crystal structure of pyrococcus yayanosii glyoxylate hydroxypyruvate reductase in complex with NADP and malonate (re-refinement of 5aow) (see paper)
39% identity, 98% coverage: 2:315/319 of query aligns to 3:317/332 of 6biiA
- active site: L99 (= L99), R240 (= R237), D264 (= D261), E269 (= E266), H287 (= H285)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V75 (= V75), T103 (= T103), G156 (= G152), F157 (≠ L153), G158 (= G154), R159 (≠ K155), I160 (= I156), A179 (≠ N176), R180 (= R177), S181 (= S178), K183 (≠ N180), V211 (≠ T208), P212 (≠ A209), E216 (= E213), T217 (= T214), V238 (≠ T235), A239 (= A236), R240 (= R237), D264 (= D261), H287 (= H285), G289 (= G287)
O58320 Glyoxylate reductase; EC 1.1.1.26 from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
39% identity, 98% coverage: 2:315/319 of query aligns to 4:318/334 of O58320
2dbqA Crystal structure of glyoxylate reductase (ph0597) from pyrococcus horikoshii ot3, complexed with NADP (i41) (see paper)
39% identity, 98% coverage: 2:315/319 of query aligns to 4:318/333 of 2dbqA
- active site: L100 (= L99), R241 (= R237), D265 (= D261), E270 (= E266), H288 (= H285)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V76 (= V75), T104 (= T103), L158 (= L153), G159 (= G154), R160 (≠ K155), I161 (= I156), S180 (≠ N176), R181 (= R177), T182 (≠ S178), A211 (≠ H207), V212 (≠ T208), P213 (≠ A209), T218 (= T214), I239 (≠ T235), A240 (= A236), R241 (= R237), D265 (= D261), H288 (= H285), G290 (= G287)
1wwkA Crystal structure of phosphoglycerate dehydrogenase from pyrococcus horikoshii ot3
35% identity, 97% coverage: 1:311/319 of query aligns to 1:304/304 of 1wwkA
- active site: S96 (≠ L99), R230 (= R237), D254 (= D261), E259 (= E266), H278 (= H285)
- binding nicotinamide-adenine-dinucleotide: V100 (≠ T103), G146 (= G152), F147 (≠ L153), G148 (= G154), R149 (≠ K155), I150 (= I156), Y168 (≠ H175), D169 (≠ N176), P170 (≠ R177), V201 (≠ T208), P202 (≠ A209), T207 (= T214), T228 (= T235), S229 (≠ A236), D254 (= D261), H278 (= H285), G280 (= G287)
3bazA Structure of hydroxyphenylpyruvate reductase from coleus blumei in complex with NADP+ (see paper)
36% identity, 82% coverage: 57:319/319 of query aligns to 56:311/311 of 3bazA
- active site: L98 (= L99), R230 (= R237), A251 (= A258), D254 (= D261), E259 (= E266), H277 (= H285)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V74 (= V75), G149 (= G152), L150 (= L153), G151 (= G154), R152 (≠ K155), I153 (= I156), S172 (≠ N176), R173 (= R177), S174 (= S178), C201 (≠ T208), P202 (≠ A209), T207 (= T214), I228 (≠ T235), G229 (≠ A236), R230 (= R237), D254 (= D261), H277 (= H285), G279 (= G287)
Q65CJ7 Hydroxyphenylpyruvate reductase; HPPR; EC 1.1.1.237 from Plectranthus scutellarioides (Coleus) (Solenostemon scutellarioides) (see paper)
36% identity, 82% coverage: 57:319/319 of query aligns to 58:313/313 of Q65CJ7
O43175 D-3-phosphoglycerate dehydrogenase; 3-PGDH; 2-oxoglutarate reductase; Malate dehydrogenase; EC 1.1.1.95; EC 1.1.1.399; EC 1.1.1.37 from Homo sapiens (Human) (see 3 papers)
31% identity, 98% coverage: 2:314/319 of query aligns to 8:312/533 of O43175
- T78 (≠ V75) binding
- R135 (≠ N132) to W: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606949
- RI 155:156 (≠ KI 155:156) binding
- D175 (≠ N176) binding
- T207 (= T208) binding
- CAR 234:236 (≠ TAR 235:237) binding
- D260 (= D261) binding
- V261 (= V262) to M: in PHGDHD; results in a four-fold decrease in substrate affinity and a slight increase in maximal enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs267606947
- HLGA 283:286 (≠ HIGS 285:288) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
- 373 A → T: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs201553627
- 377 G → S: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606948
- 425 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907988
- 490 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907987
6rj3A Crystal structure of phgdh in complex with compound 15 (see paper)
32% identity, 94% coverage: 2:301/319 of query aligns to 2:293/297 of 6rj3A
6plfA Crystal structure of human phgdh complexed with compound 1 (see paper)
31% identity, 97% coverage: 2:311/319 of query aligns to 4:305/305 of 6plfA
6cwaA Crystal structure phgdh in complex with nadh and 3-phosphoglycerate at 1.77 a resolution (see paper)
32% identity, 94% coverage: 2:301/319 of query aligns to 2:293/299 of 6cwaA
- binding 1,4-dihydronicotinamide adenine dinucleotide: N96 (≠ L99), A100 (≠ T103), R149 (≠ K155), I150 (= I156), Y168 (≠ H175), D169 (≠ N176), P170 (≠ R177), I171 (≠ S178), H200 (= H207), T201 (= T208), P202 (≠ A209), T207 (= T214), C228 (≠ T235), A229 (= A236), R230 (= R237), H277 (= H285), G279 (= G287)
6rj5A Crystal structure of phgdh in complex with compound 39 (see paper)
32% identity, 94% coverage: 2:301/319 of query aligns to 3:294/301 of 6rj5A
7ewhA Crystal structure of human phgdh in complex with homoharringtonine (see paper)
32% identity, 94% coverage: 2:301/319 of query aligns to 3:294/302 of 7ewhA
- binding (3beta)-O~3~-[(2R)-2,6-dihydroxy-2-(2-methoxy-2-oxoethyl)-6-methylheptanoyl]cephalotaxine: L146 (≠ F151), G147 (= G152), L148 (= L153), G149 (= G154), R150 (≠ K155), I151 (= I156), G152 (= G157), D170 (≠ N176), H201 (= H207), T202 (= T208), P203 (≠ A209)
6rihA Crystal structure of phgdh in complex with compound 9 (see paper)
32% identity, 94% coverage: 2:301/319 of query aligns to 3:294/302 of 6rihA
7dkmA Phgdh covalently linked to oridonin (see paper)
32% identity, 94% coverage: 2:301/319 of query aligns to 4:295/306 of 7dkmA
- binding nicotinamide-adenine-dinucleotide: T74 (≠ V75), A102 (≠ T103), G148 (= G152), R151 (≠ K155), I152 (= I156), Y170 (≠ H175), D171 (≠ N176), P172 (≠ R177), I173 (≠ S178), H202 (= H207), T203 (= T208), P204 (≠ A209), T209 (= T214), C230 (≠ T235), A231 (= A236), R232 (= R237), H279 (= H285), G281 (= G287)
- binding (1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14R,16beta)-1,6,7,14-tetrahydroxy-7,20-epoxykauran-15-one: C14 (≠ V12), K17 (= K15), I18 (≠ E16), E293 (≠ Q299)
6plgA Crystal structure of human phgdh complexed with compound 15 (see paper)
32% identity, 94% coverage: 2:301/319 of query aligns to 3:294/303 of 6plgA
6rj2A Crystal structure of phgdh in complex with compound 40 (see paper)
31% identity, 94% coverage: 3:301/319 of query aligns to 1:291/299 of 6rj2A
- binding ~{N}-[(1~{R})-1-[4-(ethanoylsulfamoyl)phenyl]ethyl]-2-methyl-5-phenyl-pyrazole-3-carboxamide: G146 (= G154), I148 (= I156), Y166 (≠ H175), D167 (≠ N176), P168 (≠ R177), I169 (≠ S178), I170 (≠ R179), H198 (= H207), T199 (= T208), L208 (≠ K217), R228 (= R237)
5v6qB Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with NADP and malonate (see paper)
34% identity, 82% coverage: 54:314/319 of query aligns to 51:307/319 of 5v6qB
- active site: L96 (= L99), R230 (= R237), D254 (= D261), E259 (= E266), H277 (= H285)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V72 (= V75), V100 (≠ T103), F148 (= F151), L150 (= L153), G151 (= G154), R152 (≠ K155), I153 (= I156), T172 (≠ N176), R173 (= R177), V201 (≠ T211), P202 (= P212), S206 (≠ D216), T207 (≠ K217), V228 (≠ T235), G229 (≠ A236), R230 (= R237), H277 (= H285), A279 (≠ G287)
Query Sequence
>CA265_RS17230 FitnessBrowser__Pedo557:CA265_RS17230
MKVFISGNIASVGIKELEENNITITQWKENRQITAEELIAACQDQDALISVGPNKINAAF
LKACSHLKVIALHSVGYDQVDVAAAKKLNIPIGNTPGVLSKATADTAFLLMLAVSRKAFF
AHKKIIKGEWKNYEPTPELGIEVNGKTLGIFGLGKIGLEMAKKCIGAYQMPVIYHNRSRN
EEAEKEIGAKYVSFETLLAQSDVLSVHTALTPETKDKFTLDVFKQMKANSIFINTARGAI
HNEKDLIKALEKKIIWGAGLDVTNPEPMDKNNPLLSMENVAVLPHIGSATEETRAAMAQI
IVKNIIAGLNGEKLPFEVV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory