SitesBLAST
Comparing CA265_RS17590 FitnessBrowser__Pedo557:CA265_RS17590 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q16836 Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial; HCDH; Medium and short-chain L-3-hydroxyacyl-coenzyme A dehydrogenase; Short-chain 3-hydroxyacyl-CoA dehydrogenase; EC 1.1.1.35 from Homo sapiens (Human) (see 7 papers)
33% identity, 38% coverage: 6:308/802 of query aligns to 27:312/314 of Q16836
- GGGLMG 34:39 (≠ GSGIMG 13:18) binding
- A40 (≠ S19) to T: in HADH deficiency; dbSNP:rs137853101
- D57 (= D36) binding ; to E: in HADH deficiency; dbSNP:rs137853102; to G: found in a patient with Reye-like syndrome. Does not affect 3-hydroxyacyl-CoA dehydrogenase activity. Increases KM value for NADH. Does not affect dimerization
- S73 (≠ T52) binding
- K80 (= K59) binding
- L86 (≠ T73) to P: in dbSNP:rs4956145
- E122 (= E111) binding
- K127 (= K116) binding ; modified: N6-(2-hydroxyisobutyryl)lysine
- S149 (= S138) binding ; binding
- Q152 (≠ P141) to H: in dbSNP:rs1051519
- N173 (= N164) binding
- Y226 (≠ S218) to H: found in a patient with Reye-like syndrome; loss of 3-hydroxyacyl-CoA dehydrogenase activity. Does not affect dimerization; dbSNP:rs146036912
- P258 (≠ T251) to L: in HHF4; loss of 3-hydroxyacyl-CoA dehydrogenase activity; dbSNP:rs137853103
- K305 (= K301) binding
1f0yA L-3-hydroxyacyl-coa dehydrogenase complexed with acetoacetyl-coa and NAD+ (see paper)
33% identity, 38% coverage: 6:308/802 of query aligns to 4:289/291 of 1f0yA
- active site: S126 (= S138), H147 (= H161), E159 (= E173), N197 (= N212)
- binding acetoacetyl-coenzyme a: S50 (≠ T52), K57 (= K59), S126 (= S138), H147 (= H161), F149 (= F163), N150 (= N164), P151 (= P165), P153 (≠ R167), V154 (≠ Y168), N197 (= N212), P232 (= P247), M233 (≠ S249), L238 (≠ T254)
- binding nicotinamide-adenine-dinucleotide: G13 (= G15), L14 (≠ I16), M15 (= M17), D34 (= D36), Q35 (≠ I37), A96 (≠ V108), I97 (≠ V109), E99 (= E111), K104 (= K116), N124 (= N136), S126 (= S138), H147 (= H161), N150 (= N164), V242 (= V258), T246 (= T262), K282 (= K301)
P00348 Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial; HCDH; L-3-hydroxyacyl CoA dehydrogenase; Medium and short-chain L-3-hydroxyacyl-coenzyme A dehydrogenase; Short-chain 3-hydroxyacyl-CoA dehydrogenase; EC 1.1.1.35 from Sus scrofa (Pig) (see paper)
33% identity, 38% coverage: 6:308/802 of query aligns to 27:312/314 of P00348
1f17A L-3-hydroxyacyl-coa dehydrogenase complexed with nadh (see paper)
33% identity, 38% coverage: 6:308/802 of query aligns to 4:289/293 of 1f17A
- active site: S126 (= S138), H147 (= H161), E159 (= E173), N197 (= N212)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G13 (= G15), L14 (≠ I16), M15 (= M17), D34 (= D36), Q35 (vs. gap), A96 (≠ V108), I97 (≠ V109), E99 (= E111), K104 (= K116), N124 (= N136), S126 (= S138), H147 (= H161)
1f12A L-3-hydroxyacyl-coa dehydrogenase complexed with 3-hydroxybutyryl-coa (see paper)
33% identity, 38% coverage: 6:308/802 of query aligns to 4:289/293 of 1f12A
- active site: S126 (= S138), H147 (= H161), E159 (= E173), N197 (= N212)
- binding 3-hydroxybutanoyl-coenzyme a: K57 (≠ G50), S126 (= S138), H147 (= H161), F149 (= F163), N150 (= N164), M155 (≠ L169), N197 (= N212), L200 (≠ G215), P232 (= P247), M233 (≠ S249), L238 (≠ T254)
P9WNP7 3-hydroxybutyryl-CoA dehydrogenase; Beta-hydroxybutyryl-CoA dehydrogenase; BHBD; EC 1.1.1.157 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
32% identity, 38% coverage: 2:307/802 of query aligns to 1:284/286 of P9WNP7
- S122 (= S138) mutation to A: Loss of fatty acyl dehydrogenase activity.
6aa8E Crystal structure of (s)-3-hydroxybutyryl-coenzymea dehydrogenase from clostridium acetobutylicum complexed with NAD+ (see paper)
31% identity, 38% coverage: 8:311/802 of query aligns to 2:281/281 of 6aa8E
- active site: S116 (= S138), H137 (= H161), E149 (= E173), N187 (= N212)
- binding nicotinamide-adenine-dinucleotide: I6 (≠ L12), G9 (= G15), T10 (≠ I16), M11 (= M17), R29 (≠ L35), D30 (= D36), I31 (= I37), A86 (≠ V108), A87 (≠ V109), E89 (= E111), K94 (= K116), N114 (= N136), S116 (= S138)
4kugA Crystal structure of 3-hydroxybutylryl-coa dehydrogenase with NAD from clostridium butyricum
29% identity, 38% coverage: 6:311/802 of query aligns to 1:282/282 of 4kugA
- active site: S117 (= S138), H138 (= H161), E150 (= E173), N188 (= N212)
- binding nicotinamide-adenine-dinucleotide: G10 (= G15), T11 (≠ I16), M12 (= M17), R30 (≠ L35), D31 (= D36), A87 (≠ V108), A88 (≠ V109), E90 (= E111), N115 (= N136), S117 (= S138), H138 (= H161)
4kuhA Crystal structure of 3-hydroxybutylryl-coa dehydrogenase with acetoacetyl-coa from clostridium butyricum
29% identity, 38% coverage: 6:307/802 of query aligns to 1:278/280 of 4kuhA
3zwaA Crystal structure of rat peroxisomal multifunctional enzyme type 1 (rpmfe1) complexed with 3s-hydroxy-hexanoyl-coa (see paper)
26% identity, 53% coverage: 4:425/802 of query aligns to 300:687/727 of 3zwaA
Sites not aligning to the query:
- active site: 67, 72, 82, 106, 109, 128, 129, 136, 137, 255
- binding (S)-3-Hydroxyhexanoyl-CoA: 27, 65, 66, 67, 68, 69, 104, 109, 124, 129, 132, 137, 162
3zw9A Crystal structure of rat peroxisomal multifunctional enzyme type 1 (rpmfe1) complexed with (2s,3s)-3-hydroxy-2- methylbutanoyl-coa (see paper)
26% identity, 53% coverage: 4:425/802 of query aligns to 297:684/723 of 3zw9A
- active site: S413 (= S138), H434 (= H161), E446 (= E173), N484 (= N212)
- binding nicotinamide-adenine-dinucleotide: L305 (= L12), G306 (= G13), G308 (= G15), T309 (≠ I16), M310 (= M17), E329 (≠ D36), Q334 (≠ E41), A383 (≠ V108), V384 (= V109), F385 (≠ V110), E386 (= E111), N411 (= N136), S413 (= S138), H434 (= H161)
Sites not aligning to the query:
- active site: 64, 69, 79, 103, 106, 125, 126, 133, 134, 252
- binding (2s,3s)-3-hydroxy-2-methylbutanoyl-coa: 24, 62, 63, 64, 66, 102, 103, 106, 126, 133, 159
3zwbA Crystal structure of rat peroxisomal multifunctional enzyme type 1 (rpmfe1) complexed with 2trans-hexenoyl-coa (see paper)
26% identity, 53% coverage: 4:425/802 of query aligns to 299:686/725 of 3zwbA
Sites not aligning to the query:
- active site: 66, 81, 105, 108, 127, 128, 135, 136
- binding (2E)-Hexenoyl-CoA: 25, 26, 28, 64, 65, 66, 67, 68, 101, 103, 105, 108, 136, 161, 280
5omoA Crystal structure of rat peroxisomal multifunctional enzyme type-1 (rpmfe1) complexed with with 3s-hydroxy-decanoyl-coa and 3-keto- decanoyl-coa
26% identity, 53% coverage: 4:425/802 of query aligns to 299:686/725 of 5omoA
Sites not aligning to the query:
- active site: 66, 71, 81, 105, 108, 127, 128, 135, 136, 254
- binding (s)-3-hydroxydecanoyl-coa: 25, 26, 28, 31, 64, 66, 67, 68, 103, 105, 108, 127, 128, 161, 260, 280
5mgbA Crystal structure of rat peroxisomal multifunctional enzyme type-1 (rpmfe1) complexed with acetoacetyl-coa and NAD (see paper)
26% identity, 53% coverage: 4:425/802 of query aligns to 299:686/725 of 5mgbA
- active site: S415 (= S138), H436 (= H161), E448 (= E173), N486 (= N212)
- binding nicotinamide-adenine-dinucleotide: L307 (= L12), G308 (= G13), G310 (= G15), T311 (≠ I16), M312 (= M17), E331 (≠ D36), S332 (≠ I37), Q336 (≠ E41), V386 (= V109), F387 (≠ V110), E388 (= E111), N413 (= N136), S415 (= S138), H436 (= H161)
Sites not aligning to the query:
- active site: 66, 71, 81, 105, 108, 127, 128, 135, 136, 254
- binding acetoacetyl-coenzyme a: 25, 26, 64, 65, 66, 67, 68, 105, 128, 161
3zwcA Crystal structure of rat peroxisomal multifunctional enzyme type 1 (rpmfe1) complexed with 3s-hydroxy-decanoyl-coa (see paper)
26% identity, 53% coverage: 4:425/802 of query aligns to 299:686/725 of 3zwcA
- active site: S415 (= S138), H436 (= H161), E448 (= E173), N486 (= N212)
- binding nicotinamide-adenine-dinucleotide: G308 (= G13), G310 (= G15), T311 (≠ I16), M312 (= M17), E331 (≠ D36), Q336 (≠ E41), A385 (≠ V108), V386 (= V109), F387 (≠ V110), E388 (= E111), K393 (= K116), N413 (= N136), S415 (= S138), H436 (= H161)
Sites not aligning to the query:
- active site: 66, 71, 81, 105, 108, 127, 128, 135, 136, 254
- binding (s)-3-hydroxydecanoyl-coa: 26, 64, 65, 66, 67, 68, 77, 78, 80, 101, 104, 105, 108, 128, 260
2x58A The crystal structure of mfe1 liganded with coa (see paper)
26% identity, 53% coverage: 4:425/802 of query aligns to 299:686/725 of 2x58A
- active site: S415 (= S138), H436 (= H161), E448 (= E173), N486 (= N212)
- binding adenosine-5'-diphosphate: G310 (= G15), T311 (≠ I16), M312 (= M17), E331 (≠ D36), S332 (≠ I37), Q336 (≠ E41), V386 (= V109), L392 (≠ I115)
Sites not aligning to the query:
- active site: 66, 71, 81, 105, 108, 127, 128, 135, 136, 254
- binding coenzyme a: 26, 28, 64, 66, 67, 68, 128
6zibAAA structure of rat peroxisomal multifunctional enzyme type-1 (rpmfe1) complexed with acetoacetyl-coa and nadh'
26% identity, 53% coverage: 4:425/802 of query aligns to 299:684/723 of 6zibAAA
- active site: S413 (= S138), H434 (= H161), E446 (= E173), N484 (= N212)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G310 (= G15), T311 (≠ I16), M312 (= M17), E331 (≠ D36), S332 (≠ I37), Q336 (≠ E41), A383 (≠ V108), V384 (= V109), F385 (≠ V110), E386 (= E111), N411 (= N136), H434 (= H161)
Sites not aligning to the query:
- active site: 66, 71, 81, 105, 108, 127, 128, 136, 254
- binding acetoacetyl-coenzyme a: 25, 26, 64, 65, 66, 67, 68, 104, 105, 128, 161
6zicAAA structure of rat peroxisomal multifunctional enzyme type-1 (rpmfe1) complexed with 3s-hydroxybutanoyl-coa and nadh'
26% identity, 53% coverage: 4:425/802 of query aligns to 299:684/723 of 6zicAAA
- active site: S413 (= S138), H434 (= H161), E446 (= E173), N484 (= N212)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G308 (= G13), G310 (= G15), T311 (≠ I16), M312 (= M17), E331 (≠ D36), S332 (≠ I37), Q336 (≠ E41), A383 (≠ V108), V384 (= V109), F385 (≠ V110), E386 (= E111), L390 (≠ I115), K391 (= K116), N411 (= N136), S413 (= S138), H434 (= H161)
Sites not aligning to the query:
- active site: 66, 71, 81, 105, 108, 127, 128, 136, 254
- binding 3-hydroxybutanoyl-coenzyme a: 25, 26, 28, 66, 67, 68, 104, 105, 108, 128, 161
6z5oAAA Peroxisomal bifunctional enzyme (see paper)
25% identity, 53% coverage: 4:425/802 of query aligns to 300:680/716 of 6z5oAAA
- active site: S409 (= S138), H430 (= H161), E442 (= E173), N480 (= N212)
- binding nicotinamide-adenine-dinucleotide: G309 (= G13), G311 (= G15), T312 (≠ I16), M313 (= M17), E332 (≠ D36), S333 (≠ I37), Q337 (≠ E41), A379 (≠ V108), V380 (= V109), F381 (≠ V110), E382 (= E111), K387 (= K116), N407 (= N136), S409 (= S138), H430 (= H161)
Sites not aligning to the query:
- active site: 67, 72, 82, 106, 109, 128, 129, 137, 255
- binding coenzyme a: 26, 27, 65, 68, 69, 128, 162, 277, 281
- binding nicotinamide: 67, 109, 129, 136, 261
4pzeA Crystal structure of (s)-3-hydroxybutyryl-coa dehydrogenase paah1 in complex with acetoacetyl-coa (see paper)
30% identity, 38% coverage: 5:311/802 of query aligns to 1:283/283 of 4pzeA
Query Sequence
>CA265_RS17590 FitnessBrowser__Pedo557:CA265_RS17590
MMKRSINKVAVLGSGIMGSRIACHFANIGVEVLLLDIAPKELSPEEQAKGLTLDNPAVKN
RIVNTALQTAVKTNPSPVYTKKALNKIKTGNFADDMSKIAGYDWVIEVVVENLDIKKKVF
EQVEQFRKPGTLITSNTSGIPIHLMAEGRSEDFKAHFCGTHFFNPPRYLKLLEIIPTPHT
QPEIVDFLMHYGDKFLGKTTVLCKDTPAFIANRVGVYSIMALLHLVEKLDLTVEEVDKFT
GPALGRPKSATFRTSDVVGLDTMIKVAKGLYDNCPDDKAHDLFKLPAYVQKMEENKWLGD
KTQQGFYKKTKSADGKTEILALDLKTLEYKPQQKVKSATLEMTKPIENLRERMKIFAKGK
DKAGELFRHSSFGLFEYVSDRIPEISDELYRIDDAMRAGFGWELGPFELWDAVGVKEAIE
GMEQYGNKAAAWVHEMLDAGNTSFYKVENGVKKYYDIPSKSYKALPGTDEFIILDNLREN
KTLWKNSGVSIIDLGDGILNVEFHTKMNTIGGDVISGINKAIDMAEKDYRGLVIGNDGAN
FSAGANVGMIFMMAVEQEWDELNMAIRMFQNTSMRIRYSSIPVVVAPHNLTLGGGCEFSL
HADHVQLSAETYMGLVEFGVGVIPGGGGTKEFALRASDEYKDDQIVQNALKDRFLTIGMA
KVSTSGYEAYELGYLQKDKFSISMNRNRLLADAKAKAIELADAGYTKPVQRNDIKVLGKQ
GLGIVYAGANSMYAGHFISEHDKKISEKLGYVMCGGDLSAPTEVTEQYLLDLEREAFLSL
AGERKSLERIQSIITKGKPLRN
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory