Comparing CA265_RS18205 FitnessBrowser__Pedo557:CA265_RS18205 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2dcnA Crystal structure of 2-keto-3-deoxygluconate kinase from sulfolobus tokodaii complexed with 2-keto-6-phosphogluconate (alpha-furanose form)
30% identity, 90% coverage: 4:266/293 of query aligns to 2:278/308 of 2dcnA
Sites not aligning to the query:
Q8ZKR2 Aminoimidazole riboside kinase; AIRs kinase; EC 2.7.1.223 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
25% identity, 95% coverage: 3:279/293 of query aligns to 5:293/319 of Q8ZKR2
5eynA Crystal structure of fructokinase from vibrio cholerae o395 in fructose, adp, beryllium trifluoride and calcium ion bound form
28% identity, 95% coverage: 3:279/293 of query aligns to 2:291/306 of 5eynA
2varA Crystal structure of sulfolobus solfataricus 2-keto-3-deoxygluconate kinase complexed with 2-keto-3-deoxygluconate (see paper)
28% identity, 94% coverage: 5:280/293 of query aligns to 3:294/311 of 2varA
Q97U29 2-dehydro-3-deoxygluconokinase/2-dehydro-3-deoxygalactonokinase; 2-dehydro-3-deoxyglucono/galactono-kinase; 2-keto-3-deoxy-galactonokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; KDGal kinase; EC 2.7.1.178 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
28% identity, 94% coverage: 5:280/293 of query aligns to 4:295/313 of Q97U29
5yggA Crystal structure of fructokinase double-mutant (t261c-h108c) from vibrio cholerae o395 in fructose, adp and potassium ion bound form (see paper)
28% identity, 95% coverage: 3:279/293 of query aligns to 6:295/310 of 5yggA
1tz3A Crystal structure of aminoimidazole riboside kinase complexed with aminoimidazole riboside (see paper)
26% identity, 85% coverage: 3:250/293 of query aligns to 1:248/299 of 1tz3A
1tz6A Crystal structure of aminoimidazole riboside kinase from salmonella enterica complexed with aminoimidazole riboside and atp analog (see paper)
26% identity, 85% coverage: 3:250/293 of query aligns to 1:248/297 of 1tz6A
Sites not aligning to the query:
3ih0A Crystal structure of an uncharacterized sugar kinase ph1459 from pyrococcus horikoshii in complex with amp-pnp
27% identity, 84% coverage: 5:250/293 of query aligns to 3:253/304 of 3ih0A
Sites not aligning to the query:
3gbuA Crystal structure of an uncharacterized sugar kinase ph1459 from pyrococcus horikoshii in complex with atp
27% identity, 84% coverage: 5:250/293 of query aligns to 2:252/302 of 3gbuA
Sites not aligning to the query:
4wjmA Crystal structure of fructokinase from brucella abortus 2308 with bound amppnp
26% identity, 97% coverage: 5:287/293 of query aligns to 8:312/312 of 4wjmA
4xckA Vibrio cholerae o395 ribokinase complexed with adp, ribose and cesium ion. (see paper)
27% identity, 86% coverage: 13:263/293 of query aligns to 33:272/306 of 4xckA
Sites not aligning to the query:
7fcaD Pfkb(mycobacterium marinum) (see paper)
28% identity, 84% coverage: 4:250/293 of query aligns to 3:237/282 of 7fcaD
1v1aA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound 2- keto-3-deoxygluconate and adp (see paper)
26% identity, 94% coverage: 4:278/293 of query aligns to 3:286/301 of 1v1aA
Sites not aligning to the query:
1v1bA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound atp (see paper)
26% identity, 94% coverage: 4:278/293 of query aligns to 3:286/300 of 1v1bA
Q53W83 2-dehydro-3-deoxygluconokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; EC 2.7.1.45 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
26% identity, 94% coverage: 4:278/293 of query aligns to 3:286/309 of Q53W83
Sites not aligning to the query:
3uq9A Adenosine kinase from schistosoma mansoni in complex with tubercidin (see paper)
24% identity, 88% coverage: 22:278/293 of query aligns to 60:335/345 of 3uq9A
Sites not aligning to the query:
3uq6A Adenosine kinase from schistosoma mansoni in complex with adenosine and amp (see paper)
24% identity, 88% coverage: 22:278/293 of query aligns to 60:335/345 of 3uq6A
Sites not aligning to the query:
4dc3B Adenosine kinase from schistosoma mansoni in complex with 2- fluoroadenosine (see paper)
24% identity, 88% coverage: 22:278/293 of query aligns to 60:335/344 of 4dc3B
Sites not aligning to the query:
P0A9J6 Ribokinase; RK; EC 2.7.1.15 from Escherichia coli (strain K12) (see 3 papers)
25% identity, 88% coverage: 23:281/293 of query aligns to 41:293/309 of P0A9J6
Sites not aligning to the query:
>CA265_RS18205 FitnessBrowser__Pedo557:CA265_RS18205
MQNKVITIGEILWDVFPEGKKAGGSSMNVALNLHKQSIESSFISAVGDDENGKELFNFLA
SNHFATDLIQVNSELPTSTVVVQLDENHQATYTIKQPVAWDDIKITDENIAAVKQADALV
YCSLTCRSEQSKKAILKLLENAKTKIFDINLRAPFYTRELIAELLTKADILKINEDEILW
VKESFGLSGNTDEQLLKQLSSQFNIEIICLTLGDKGACVLKDGKLFKHAGYKVQVADTVG
AGDAFLATFIACYLQGYPMETTLDNACKVGAFVASQAGANPEYNKKIYHMALG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory