Comparing CA265_RS18500 FitnessBrowser__Pedo557:CA265_RS18500 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
P44514 Succinyl-diaminopimelate desuccinylase; SDAP desuccinylase; N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase; EC 3.5.1.18 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 3 papers)
24% identity, 97% coverage: 6:349/355 of query aligns to 1:371/377 of P44514
5vo3A Crystal structure of dape in complex with the products (succinic acid and diaminopimelic acid) (see paper)
24% identity, 97% coverage: 6:349/355 of query aligns to 5:375/380 of 5vo3A
7uoiA Crystallographic structure of dape from enterococcus faecium
24% identity, 95% coverage: 7:345/355 of query aligns to 7:374/383 of 7uoiA
7lgpB Dape enzyme from shigella flexneri
24% identity, 72% coverage: 11:266/355 of query aligns to 8:273/377 of 7lgpB
P37111 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Sus scrofa (Pig) (see paper)
27% identity, 68% coverage: 10:249/355 of query aligns to 12:276/407 of P37111
Sites not aligning to the query:
Q03154 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Homo sapiens (Human) (see 6 papers)
25% identity, 68% coverage: 7:249/355 of query aligns to 9:277/408 of Q03154
Sites not aligning to the query:
7rsfA Acetylornithine deacetylase from escherichia coli
25% identity, 76% coverage: 66:336/355 of query aligns to 72:361/380 of 7rsfA
7m6uB Crystal structure of a circular permutation and computationally designed pro-enzyme of carboxypeptidase g2 (see paper)
29% identity, 52% coverage: 66:248/355 of query aligns to 17:198/392 of 7m6uB
Sites not aligning to the query:
P06621 Carboxypeptidase G2; CPDG2; Folate hydrolase G2; Glutamate carboxypeptidase; Pteroylmonoglutamic acid hydrolase G2; Glucarpidase; EC 3.4.17.11 from Pseudomonas sp. (strain RS-16) (see paper)
29% identity, 52% coverage: 66:248/355 of query aligns to 107:288/415 of P06621
Sites not aligning to the query:
1cg2A Carboxypeptidase g2 (see paper)
29% identity, 52% coverage: 66:248/355 of query aligns to 82:263/389 of 1cg2A
Sites not aligning to the query:
7t1qA Crystal structure of the succinyl-diaminopimelate desuccinylase (dape) from acinetobacter baumannii in complex with succinic acid
23% identity, 62% coverage: 49:267/355 of query aligns to 48:277/377 of 7t1qA
Sites not aligning to the query:
>CA265_RS18500 FitnessBrowser__Pedo557:CA265_RS18500
MSLENIQKESLDLLRQLIRIQSFSKEEDRTANLIAQFLEERGIKTQRKMNNVWAYNKHFD
ATKPTLLLNSHHDTVKPNSGYTRDPYDAAIEGDKLFGLGSNDAGGCLVSLIGTFLYYYEQ
EGLKYNICLAATAEEEISGNNGLELVLPDLGELEFGIVGEPTEMNLAIAERGLLVLDCVS
HGKAGHAAREEGENAIYKALKDIEWFRNYQFPKVSEVFGPLKMTVTIINAGSQHNVVPAN
CTFTVDVRVTDAYTNEEVLEIIRANVDCDVTPRSIRLKPSSIDKNHPVVQAGVALGKTTY
GSPTTSDQALLDIPSVKCGPGFSGRSHMADEFLYVREVAEGVEGYVNMLRPVVIG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory