Comparing CA265_RS18510 CA265_RS18510 acetylglutamate kinase to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9HTN2 Acetylglutamate kinase; N-acetyl-L-glutamate 5-phosphotransferase; NAG kinase; NAGK; EC 2.7.2.8 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see 2 papers)
34% identity, 90% coverage: 8:258/278 of query aligns to 31:272/301 of Q9HTN2
Sites not aligning to the query:
2bufC Arginine feed-back inhibitable acetylglutamate kinase (see paper)
34% identity, 90% coverage: 8:258/278 of query aligns to 30:271/298 of 2bufC
2bufA Arginine feed-back inhibitable acetylglutamate kinase (see paper)
34% identity, 90% coverage: 8:258/278 of query aligns to 30:263/292 of 2bufA
2v5hB Controlling the storage of nitrogen as arginine: the complex of pii and acetylglutamate kinase from synechococcus elongatus pcc 7942 (see paper)
32% identity, 91% coverage: 5:258/278 of query aligns to 23:258/289 of 2v5hB
2btyA Acetylglutamate kinase from thermotoga maritima complexed with its inhibitor arginine (see paper)
36% identity, 90% coverage: 8:258/278 of query aligns to 25:254/282 of 2btyA
Sites not aligning to the query:
Q9X2A4 Acetylglutamate kinase; N-acetyl-L-glutamate 5-phosphotransferase; NAG kinase; NAGK; EC 2.7.2.8 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
36% identity, 90% coverage: 8:258/278 of query aligns to 25:254/282 of Q9X2A4
Sites not aligning to the query:
Q9SCL7 Acetylglutamate kinase, chloroplastic; N-acetyl-L-glutamate 5-phosphotransferase; NAG kinase; AtNAGK; EC 2.7.2.8 from Arabidopsis thaliana (Mouse-ear cress) (see 3 papers)
33% identity, 90% coverage: 8:258/278 of query aligns to 89:322/347 of Q9SCL7
Sites not aligning to the query:
2rd5B Structural basis for the regulation of n-acetylglutamate kinase by pii in arabidopsis thaliana (see paper)
33% identity, 90% coverage: 8:258/278 of query aligns to 25:258/283 of 2rd5B
Sites not aligning to the query:
4usjB N-acetylglutamate kinase from arabidopsis thaliana in complex with pii from chlamydomonas reinhardtii (see paper)
33% identity, 90% coverage: 8:258/278 of query aligns to 23:256/281 of 4usjB
Sites not aligning to the query:
3wwmA Crystal structure of lysz from thermus thermophilus with adp (see paper)
35% identity, 81% coverage: 37:261/278 of query aligns to 32:251/269 of 3wwmA
Sites not aligning to the query:
O50147 [LysW]-aminoadipate kinase; EC 2.7.2.17 from Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) (see paper)
35% identity, 81% coverage: 37:261/278 of query aligns to 32:251/269 of O50147
2bufK Arginine feed-back inhibitable acetylglutamate kinase (see paper)
31% identity, 90% coverage: 8:258/278 of query aligns to 30:248/273 of 2bufK
7nnbA Crystal structure of mycobacterium tuberculosis argb in complex with 2,8-bis(trifluoromethyl)quinolin-4-ol.
28% identity, 91% coverage: 5:258/278 of query aligns to 26:265/291 of 7nnbA
7nn8A Crystal structure of mycobacterium tuberculosis argb in complex with 1h-indole-3-carbonitrile.
28% identity, 91% coverage: 5:258/278 of query aligns to 26:265/291 of 7nn8A
7nm0A Crystal structure of mycobacterium tuberculosis argb in complex with 1-(2,6-dihydroxyphenyl)ethan-1-one.
28% identity, 91% coverage: 5:258/278 of query aligns to 26:265/291 of 7nm0A
7nlzA Crystal structure of mycobacterium tuberculosis argb in complex with 5-methoxy-6-(trifluoromethyl)indole.
28% identity, 91% coverage: 5:258/278 of query aligns to 26:265/291 of 7nlzA
7nltA Crystal structure of mycobacterium tuberculosis argb in complex with 4-(4-methylpiperazin-1-yl)benzoic acid
28% identity, 91% coverage: 5:258/278 of query aligns to 26:265/291 of 7nltA
7nlrA Crystal structure of mycobacterium tuberculosis argb in complex with 2-phenyl-1h-imidazole
28% identity, 91% coverage: 5:258/278 of query aligns to 26:265/291 of 7nlrA
7nloA Crystal structure of mycobacterium tuberculosis argb in complex with l-arginine
28% identity, 91% coverage: 5:258/278 of query aligns to 24:263/289 of 7nloA
Sites not aligning to the query:
7nlwA Crystal structure of mycobacterium tuberculosis argb in complex with 2-(5-methoxy-1h-indol-3-yl)acetonitrile
28% identity, 91% coverage: 5:258/278 of query aligns to 26:265/290 of 7nlwA
>CA265_RS18510 CA265_RS18510 acetylglutamate kinase
MKNKQLTIIKIGGNVIDNSENLHQFLLDFTALPGDKILVHGGGKIATELGESLGIEAKMI
DGRRITDIETLRIVTMVYAGLINKNMVAQLQAKGSNAIGLSGADGNVIRAKKRPVITKTY
GAESGPMAGAVIDYGFVGDLDENAVSSTTLESLLKAGLVPVLCAITHDGDTQLLNTNADT
IASSVAVAMSALYETRLVYCFEKKGVLKNVNDDGSVVREIKADEFEGLKADGTVQGGMIP
KLHNAFEAIKKGVSAVYIGKADELAELAEGTFGTKMLK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory