Comparing CA265_RS18530 CA265_RS18530 aspartate aminotransferase family protein to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1wkhA Acetylornithine aminotransferase from thermus thermophilus hb8
35% identity, 96% coverage: 6:370/382 of query aligns to 15:381/387 of 1wkhA
Sites not aligning to the query:
1wkgA Acetylornithine aminotransferase from thermus thermophilus hb8
35% identity, 96% coverage: 6:370/382 of query aligns to 15:381/387 of 1wkgA
Sites not aligning to the query:
1vefA Acetylornithine aminotransferase from thermus thermophilus hb8
35% identity, 96% coverage: 6:370/382 of query aligns to 15:381/387 of 1vefA
Sites not aligning to the query:
Q5SHH5 [LysW]-aminoadipate semialdehyde transaminase; EC 2.6.1.118 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
35% identity, 96% coverage: 6:370/382 of query aligns to 23:389/395 of Q5SHH5
8ht4B Crystal structure of acetylornithine aminotransferase complex with plp from corynebacterium glutamicum
37% identity, 98% coverage: 3:375/382 of query aligns to 10:385/390 of 8ht4B
Q9X2A5 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
35% identity, 99% coverage: 1:378/382 of query aligns to 1:385/385 of Q9X2A5
2ordA Crystal structure of acetylornithine aminotransferase (ec 2.6.1.11) (acoat) (tm1785) from thermotoga maritima at 1.40 a resolution
35% identity, 99% coverage: 1:378/382 of query aligns to 9:393/393 of 2ordA
4jevB N-acetylornithine aminotransferase from s. Typhimurium complexed with gabaculine
34% identity, 98% coverage: 3:378/382 of query aligns to 12:398/402 of 4jevB
P40732 Acetylornithine/succinyldiaminopimelate aminotransferase; ACOAT; DapATase; Succinyldiaminopimelate transferase; EC 2.6.1.11; EC 2.6.1.17 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
34% identity, 98% coverage: 3:378/382 of query aligns to 17:403/405 of P40732
4jewA N-acetylornithine aminotransferase from s. Typhimurium complexed with l-canaline
33% identity, 98% coverage: 3:378/382 of query aligns to 12:393/397 of 4jewA
A0QYS9 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
34% identity, 97% coverage: 3:371/382 of query aligns to 11:379/390 of A0QYS9
2pb0A Structure of biosynthetic n-acetylornithine aminotransferase from salmonella typhimurium: studies on substrate specificity and inhibitor binding (see paper)
33% identity, 98% coverage: 3:378/382 of query aligns to 6:387/389 of 2pb0A
Q9M8M7 Acetylornithine aminotransferase, chloroplastic/mitochondrial; ACOAT; Acetylornithine transaminase; AOTA; Protein HOPW1-1-INTERACTING 1; EC 2.6.1.11 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
33% identity, 93% coverage: 7:361/382 of query aligns to 73:439/457 of Q9M8M7
Sites not aligning to the query:
2eh6A Crystal structure of acetylornithine aminotransferase from aquifex aeolicus vf5
35% identity, 97% coverage: 3:373/382 of query aligns to 3:373/375 of 2eh6A
O66442 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Aquifex aeolicus (strain VF5)
35% identity, 97% coverage: 3:373/382 of query aligns to 4:374/376 of O66442
P42588 Putrescine aminotransferase; PAT; PATase; Cadaverine transaminase; Diamine transaminase; Putrescine transaminase; Putrescine--2-oxoglutaric acid transaminase; Putrescine:2-OG aminotransferase; EC 2.6.1.82; EC 2.6.1.29 from Escherichia coli (strain K12) (see paper)
33% identity, 95% coverage: 12:375/382 of query aligns to 66:449/459 of P42588
1szkA The structure of gamma-aminobutyrate aminotransferase mutant: e211s (see paper)
36% identity, 85% coverage: 16:341/382 of query aligns to 28:375/425 of 1szkA
Sites not aligning to the query:
4uoxC Crystal structure of ygjg in complex with pyridoxal-5'-phosphate and putrescine (see paper)
33% identity, 95% coverage: 12:375/382 of query aligns to 64:447/456 of 4uoxC
Sites not aligning to the query:
4uoxA Crystal structure of ygjg in complex with pyridoxal-5'-phosphate and putrescine (see paper)
34% identity, 95% coverage: 18:378/382 of query aligns to 64:446/453 of 4uoxA
Sites not aligning to the query:
P22256 4-aminobutyrate aminotransferase GabT; 5-aminovalerate transaminase; GABA aminotransferase; GABA-AT; Gamma-amino-N-butyrate transaminase; GABA transaminase; Glutamate:succinic semialdehyde transaminase; L-AIBAT; EC 2.6.1.19; EC 2.6.1.48 from Escherichia coli (strain K12) (see 2 papers)
36% identity, 85% coverage: 16:341/382 of query aligns to 29:376/426 of P22256
>CA265_RS18530 CA265_RS18530 aspartate aminotransferase family protein
MQLFDVYPLNDIEITKAAGSNVWDANDQQYLDLYGGHAVISIGHTNPHYVNRLTDQLNKV
GFYSNSVKIPLQVQLAEKLGEVSGKKDFQLFLCNSGAEANENALKLASFYNGRKKVIAFT
GAFHGRTSLAVAVTDNPKIVAPVNQTENVIFLPFNNEIALEETFKAQGNEISAVIIEGIQ
GVGGIKEASKSFLQKIRSLCDEYNAVYIADSVQCGYGRTGSFYSHDYSGVEADVYTMAKG
MGNGFPVAGISIASKFKPWHGELGTTFGGNHLACAAALAVLEVMEKDNLIKNAEEVGNYL
IAELKKFEQVVEVRGRGLMIGIELPAELAHVKKELLFTHHIFTGEAKPNVIRLLPALNLT
KAHADEFLAAFEKAVKGVGQKA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory