Comparing CA265_RS18550 FitnessBrowser__Pedo557:CA265_RS18550 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 17 hits to proteins with known functional sites (download)
5vdbA Crystal structure of a gnat superfamily acetyltransferase pa4794 in complex with bisubstrate analog 3 (see paper)
31% identity, 38% coverage: 54:141/232 of query aligns to 52:140/159 of 5vdbA
Sites not aligning to the query:
4l8aA Crystal structure of a gnat superfamily acetyltransferase pa4794 in ternary complex with n-phenylacetyl-gly-aclys and coa (see paper)
31% identity, 38% coverage: 54:141/232 of query aligns to 52:140/159 of 4l8aA
Sites not aligning to the query:
4koyA Crystal structure of a gnat superfamily acetyltransferase pa4794 in complex with cephalosporin c (see paper)
31% identity, 38% coverage: 54:141/232 of query aligns to 52:140/159 of 4koyA
Sites not aligning to the query:
4koxA Crystal structure of a gnat superfamily acetyltransferase pa4794 in complex with cefalotin (see paper)
31% identity, 38% coverage: 54:141/232 of query aligns to 52:140/159 of 4koxA
Sites not aligning to the query:
4kowA Crystal structure of a gnat superfamily acetyltransferase pa4794 in complex with cefoxitin (see paper)
31% identity, 38% coverage: 54:141/232 of query aligns to 52:140/159 of 4kowA
Sites not aligning to the query:
4kovA Crystal structure of a gnat superfamily acetyltransferase pa4794 in complex with cefuroxime (see paper)
31% identity, 38% coverage: 54:141/232 of query aligns to 52:140/159 of 4kovA
Sites not aligning to the query:
4kouA Crystal structure of a gnat superfamily acetyltransferase pa4794 in complex with cefixime (see paper)
31% identity, 38% coverage: 54:141/232 of query aligns to 52:140/159 of 4kouA
Sites not aligning to the query:
4kotA Crystal structure of a gnat superfamily acetyltransferase pa4794 in complex with cefotaxime (see paper)
31% identity, 38% coverage: 54:141/232 of query aligns to 52:140/159 of 4kotA
Sites not aligning to the query:
4kosA Crystal structure of a gnat superfamily acetyltransferase pa4794 in complex with cefmetazole (see paper)
31% identity, 38% coverage: 54:141/232 of query aligns to 52:140/159 of 4kosA
Sites not aligning to the query:
4korA Crystal structure of a gnat superfamily acetyltransferase pa4794 in complex with 7-aminocephalosporanic acid (see paper)
31% identity, 38% coverage: 54:141/232 of query aligns to 52:140/159 of 4korA
Sites not aligning to the query:
4klwA Crystal structure of a gnat superfamily acetyltransferase pa4794 in complex with 2-(aminocarbonyl)benzoate (see paper)
31% identity, 38% coverage: 54:141/232 of query aligns to 52:140/159 of 4klwA
Sites not aligning to the query:
4klvA Crystal structure of a gnat superfamily acetyltransferase pa4794 in complex with 4-methylumbelliferyl phosphate (see paper)
31% identity, 38% coverage: 54:141/232 of query aligns to 52:140/159 of 4klvA
Sites not aligning to the query:
3pgpA Crystal structure of pa4794 - gnat superfamily protein in complex with accoa (see paper)
31% identity, 38% coverage: 54:141/232 of query aligns to 52:140/159 of 3pgpA
Sites not aligning to the query:
5vd6A Crystal structure of a gnat superfamily acetyltransferase pa4794 in complex with bisubstrate analog 6 (see paper)
31% identity, 38% coverage: 54:141/232 of query aligns to 52:140/160 of 5vd6A
Sites not aligning to the query:
4m3sA Crystal structure of a gnat superfamily acetyltransferase pa4794 in complex with hepes (see paper)
31% identity, 38% coverage: 54:141/232 of query aligns to 52:140/160 of 4m3sA
Sites not aligning to the query:
4oadA Crystal structure of a gnat superfamily acetyltransferase pa4794 in complex with chloramphenicol
31% identity, 38% coverage: 54:141/232 of query aligns to 53:141/160 of 4oadA
Sites not aligning to the query:
4kubA Crystal structure of a gnat superfamily acetyltransferase pa4794 in complex with coa (see paper)
31% identity, 38% coverage: 54:141/232 of query aligns to 53:141/160 of 4kubA
>CA265_RS18550 FitnessBrowser__Pedo557:CA265_RS18550
MDINEFIVQVALPEHRVFAEEIVTEMAESAKARGTGIAKRSPEYISNKMQEGKSVIAFHK
DGSWAGFCYIETWSHGQFVANSGLVVSPKYRKAGLAKAIKNEIFGLSRKLYPKAKIFGLT
TGLAVMKINSDLGYEPVTYSELTQDEEFWKGCQSCVNFEILKMKERKNCMCTAMLYDPAE
KKHEVAKQFAEELQKKPKLYERFMRIKQRLVVKPKPKNGLKALLFLFTFLFK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory