Comparing CA265_RS18930 FitnessBrowser__Pedo557:CA265_RS18930 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 16 hits to proteins with known functional sites (download)
3iv8A N-acetylglucosamine-6-phosphate deacetylase from vibrio cholerae complexed with fructose 6-phosphate
37% identity, 98% coverage: 5:361/363 of query aligns to 5:375/379 of 3iv8A
O32445 N-acetylglucosamine-6-phosphate deacetylase; GlcNAc 6-P deacetylase; EC 3.5.1.25 from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
37% identity, 98% coverage: 5:361/363 of query aligns to 4:374/378 of O32445
2p50A Crystal structure of n-acetyl-d-glucosamine-6-phosphate deacetylase liganded with zn (see paper)
38% identity, 90% coverage: 36:363/363 of query aligns to 42:379/382 of 2p50A
P0AF18 N-acetylglucosamine-6-phosphate deacetylase; GlcNAc 6-P deacetylase; EC 3.5.1.25 from Escherichia coli (strain K12) (see 2 papers)
38% identity, 90% coverage: 36:363/363 of query aligns to 42:379/382 of P0AF18
2p53A Crystal structure of n-acetyl-d-glucosamine-6-phosphate deacetylase d273n mutant complexed with n-acetyl phosphonamidate-d-glucosamine-6- phosphate (see paper)
38% identity, 90% coverage: 36:363/363 of query aligns to 42:379/382 of 2p53A
1yrrA Crystal structure of the n-acetylglucosamine-6-phosphate deacetylase from escherichia coli k12 at 2.0 a resolution (see paper)
38% identity, 90% coverage: 36:363/363 of query aligns to 42:378/381 of 1yrrA
2p50B Crystal structure of n-acetyl-d-glucosamine-6-phosphate deacetylase liganded with zn (see paper)
38% identity, 90% coverage: 36:363/363 of query aligns to 42:353/356 of 2p50B
1yrrB Crystal structure of the n-acetylglucosamine-6-phosphate deacetylase from escherichia coli k12 at 2.0 a resolution (see paper)
36% identity, 90% coverage: 36:363/363 of query aligns to 41:331/334 of 1yrrB
6jkuA Crystal structure of n-acetylglucosamine-6-phosphate deacetylase from pasteurella multocida (see paper)
34% identity, 98% coverage: 7:361/363 of query aligns to 13:381/385 of 6jkuA
7nutA Crystal structure of human amdhd2 in complex with zn and glcn6p (see paper)
31% identity, 99% coverage: 3:363/363 of query aligns to 20:396/401 of 7nutA
1o12A Crystal structure of n-acetylglucosamine-6-phosphate deacetylase (tm0814) from thermotoga maritima at 2.5 a resolution
31% identity, 94% coverage: 21:363/363 of query aligns to 19:360/363 of 1o12A
2vhlB The three-dimensional structure of the n-acetylglucosamine-6- phosphate deacetylase from bacillus subtilis (see paper)
31% identity, 98% coverage: 4:360/363 of query aligns to 5:383/393 of 2vhlB
O34450 N-acetylglucosamine-6-phosphate deacetylase; GlcNAc 6-P deacetylase; EC 3.5.1.25 from Bacillus subtilis (strain 168) (see paper)
31% identity, 98% coverage: 4:360/363 of query aligns to 6:384/396 of O34450
6fv4B The structure of n-acetyl-d-glucosamine-6-phosphate deacetylase d267a mutant from mycobacterium smegmatis in complex with n-acetyl-d- glucosamine-6-phosphate (see paper)
31% identity, 99% coverage: 4:363/363 of query aligns to 11:379/385 of 6fv4B
6fv4A The structure of n-acetyl-d-glucosamine-6-phosphate deacetylase d267a mutant from mycobacterium smegmatis in complex with n-acetyl-d- glucosamine-6-phosphate (see paper)
31% identity, 99% coverage: 4:363/363 of query aligns to 11:379/381 of 6fv4A
6fv3D Crystal structure of n-acetyl-d-glucosamine-6-phosphate deacetylase from mycobacterium smegmatis. (see paper)
31% identity, 99% coverage: 4:363/363 of query aligns to 9:349/350 of 6fv3D
>CA265_RS18930 FitnessBrowser__Pedo557:CA265_RS18930
MPKVITNTSYFQDNEIKSNQDILIEGSTISIINSSENKETSQSLTIPGFIDLQIYGAAGR
LFSADPTVESLTIMEDDLLKKGTTGFLACMATNSSEVFNACIKAAKEHRSAAKNCLGLHL
EGPFLNPKRLGAHVPAFVRKASLDEIKELIDFGDGVIKMMTIAPEIQDDEVIQYLLDHGV
VVSLGHSNATFDEATAAYNKGIQTTTHLFNAMSPIHHREPGIPTAVFNHNKAMASIIADG
QHVDFEVLKFAQKLLKERLFLITDAVTACSTGPYQHVEKENKYVMPDGTLSGSSITMLQA
VKNCVTHCAISLSDGVKMGTLYPAQLIGIENLTATIATGHQANLLVLDDELSLKEVIFRG
ETI
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory