Comparing CA265_RS19260 FitnessBrowser__Pedo557:CA265_RS19260 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7ac8A Molecular basis for the unique allosteric activation mechanism of the heterodimeric imidazole glycerol phosphate synthase complex. (see paper)
33% identity, 82% coverage: 1:210/255 of query aligns to 1:208/252 of 7ac8A
Sites not aligning to the query:
1gpwC Structural evidence for ammonia tunneling across the (beta/alpha)8 barrel of the imidazole glycerol phosphate synthase bienzyme complex. (see paper)
33% identity, 82% coverage: 1:210/255 of query aligns to 1:208/253 of 1gpwC
Sites not aligning to the query:
Q9X0C6 Imidazole glycerol phosphate synthase subunit HisF; IGP synthase cyclase subunit; IGP synthase subunit HisF; ImGP synthase subunit HisF; IGPS subunit HisF; EC 4.3.2.10 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
33% identity, 82% coverage: 1:210/255 of query aligns to 1:208/253 of Q9X0C6
P60664 Imidazole glycerol phosphate synthase subunit HisF; IGP synthase cyclase subunit; IGP synthase subunit HisF; ImGP synthase subunit HisF; IGPS subunit HisF; EC 4.3.2.10 from Escherichia coli (strain K12) (see paper)
31% identity, 90% coverage: 1:229/255 of query aligns to 1:234/258 of P60664
1h5yB Hisf protein from pyrobaculum aerophilum (see paper)
31% identity, 81% coverage: 5:210/255 of query aligns to 6:211/253 of 1h5yB
Sites not aligning to the query:
7qc8A Imidazole glycerol phosphate synthase subunit HisF (see paper)
32% identity, 82% coverage: 2:210/255 of query aligns to 2:208/250 of 7qc8A
5d2tA Directed evolutionary changes in kemp eliminase ke07 - crystal 3 wild type
31% identity, 89% coverage: 5:231/255 of query aligns to 3:227/251 of 5d2tA
3zr4E Structural evidence for ammonia tunneling across the (beta-alpha)8 barrel of the imidazole glycerol phosphate synthase bienzyme complex (see paper)
32% identity, 82% coverage: 1:210/255 of query aligns to 1:199/244 of 3zr4E
Sites not aligning to the query:
6dnjA Directed evolutionary changes in kemp eliminase ke07 - crystal 28 round 5 (see paper)
31% identity, 89% coverage: 7:232/255 of query aligns to 5:229/250 of 6dnjA
2wjzE Crystal structure of (hish) k181a y138a mutant of imidazoleglycerolphosphate synthase (hish hisf) which displays constitutive glutaminase activity (see paper)
32% identity, 72% coverage: 28:210/255 of query aligns to 16:194/237 of 2wjzE
Sites not aligning to the query:
3iivB Evolutionary optimization of computationally designed enzymes: kemp eliminases of the ke07 series (see paper)
30% identity, 91% coverage: 2:232/255 of query aligns to 2:227/262 of 3iivB
4ewnD Structure of hisf-d130v+d176v with bound rcdrp (see paper)
31% identity, 82% coverage: 2:210/255 of query aligns to 1:201/243 of 4ewnD
Sites not aligning to the query:
1ox5A Towards understanding the mechanism of the complex cyclization reaction catalyzed by imidazole glycerophosphate synthase (see paper)
27% identity, 84% coverage: 2:215/255 of query aligns to 239:493/532 of 1ox5A
Sites not aligning to the query:
1ox4B Towards understanding the mechanism of the complex cyclization reaction catalyzed by imidazole glycerophosphate synthase (see paper)
27% identity, 84% coverage: 2:215/255 of query aligns to 239:499/538 of 1ox4B
Sites not aligning to the query:
P33734 Imidazole glycerol phosphate synthase hisHF; IGP synthase; IGPS; ImGP synthase; EC 4.3.2.10; EC 3.5.1.2 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
26% identity, 74% coverage: 28:215/255 of query aligns to 274:511/552 of P33734
Sites not aligning to the query:
5abtA S.Enterica hisa mutant d7n, g102a, v106m, d176a
24% identity, 78% coverage: 29:226/255 of query aligns to 27:225/246 of 5abtA
Sites not aligning to the query:
5ab3A S.Enterica hisa mutant d7n, d10g, dup13-15, q24l, g102a (see paper)
25% identity, 87% coverage: 6:226/255 of query aligns to 2:222/241 of 5ab3A
Sites not aligning to the query:
Q9X0C7 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase; EC 5.3.1.16 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
27% identity, 82% coverage: 6:215/255 of query aligns to 3:206/241 of Q9X0C7
5dn1A Crystal structure of phosphoribosyl isomerase a from streptomyces coelicolor (see paper)
28% identity, 72% coverage: 31:213/255 of query aligns to 32:206/240 of 5dn1A
Sites not aligning to the query:
P16250 Phosphoribosyl isomerase A; 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; N-(5'-phosphoribosyl)anthranilate isomerase; PRAI; Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase; EC 5.3.1.16; EC 5.3.1.24 from Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) (see paper)
28% identity, 72% coverage: 31:213/255 of query aligns to 32:206/240 of P16250
Sites not aligning to the query:
>CA265_RS19260 FitnessBrowser__Pedo557:CA265_RS19260
MLKHRVIPALLLNQHGGLVKTTKFAAPKYIGDPLNAMRIFNTKEVDELMVLDIDASKLKR
EPNYGLIEQFAGECFMPLCYGGGIKTIDQAYKIFKLGVEKICLQTAVLEDLDLVRDLVAR
FGSSAIVVSVDVKKDWLQRPKLFKSSEGKNANENWISYIKQAVDAGAGEILLNAVDKDGT
LQGSDLTLIKQASGEISAPLIALGGIGSLKDIKDAVDAGASAVAAGAFFVFHGPHRAVLI
TYPQYQELLTLFNTK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory