SitesBLAST
Comparing CA265_RS19325 FitnessBrowser__Pedo557:CA265_RS19325 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1h5sB Thymidylyltransferase complexed with tmp (see paper)
67% identity, 100% coverage: 2:286/286 of query aligns to 5:290/291 of 1h5sB
- binding thymidine-5'-phosphate: L9 (= L6), G11 (= G8), G12 (= G9), Q83 (= Q80), P86 (= P83), D87 (≠ N84), G88 (= G85), D111 (= D108), Y115 (≠ H112), G116 (≠ S113), H117 (≠ D114), D118 (≠ G115), G219 (≠ S215), R220 (= R216), G221 (= G217), S252 (≠ G248), E256 (= E252), I257 (= I253), R260 (= R256)
1h5tA Thymidylyltransferase complexed with thymidylyldiphosphate-glucose (see paper)
66% identity, 100% coverage: 2:286/286 of query aligns to 4:289/290 of 1h5tA
- binding 2'deoxy-thymidine-5'-diphospho-alpha-d-glucose: L8 (= L6), G10 (= G8), Q82 (= Q80), P85 (= P83), G87 (= G85), L108 (= L106), D110 (= D108), Y145 (= Y142), G146 (= G143), E161 (= E158), K162 (= K159), V172 (= V169), R194 (= R191)
- binding thymidine-5'-diphosphate: Y114 (≠ H112), G115 (≠ S113), H116 (≠ D114), D117 (≠ G115), R219 (= R216), G220 (= G217), V250 (≠ I247), S251 (≠ G248)
1h5rA Thymidylyltransferase complexed with thimidine and glucose-1-phospate (see paper)
66% identity, 100% coverage: 2:286/286 of query aligns to 4:289/290 of 1h5rA
- binding 1-O-phosphono-alpha-D-glucopyranose: L88 (= L86), Y145 (= Y142), G146 (= G143), E161 (= E158), K162 (= K159), V172 (= V169)
- binding thymidine: L8 (= L6), G10 (= G8), G11 (= G9), Q82 (= Q80), P85 (= P83), G87 (= G85), L88 (= L86), D110 (= D108), Y114 (≠ H112), G115 (≠ S113), V250 (≠ I247), S251 (≠ G248), E255 (= E252), I256 (= I253)
P26393 Glucose-1-phosphate thymidylyltransferase; dTDP-glucose pyrophosphorylase; Ep; dTDP-glucose synthase; EC 2.7.7.24 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
66% identity, 100% coverage: 2:286/286 of query aligns to 5:290/292 of P26393
- T201 (= T197) mutation to A: Two-fold increase in the conversion of 2-acetamido-2-deoxy-alpha-D-glucopyranosyl phosphate.
- W224 (= W220) mutation to H: Is able to convert both 6-acetamido-6-deoxy-alpha-D-glucopyranosyl phosphate and alpha-D-glucopyranuronic acid 1-(dihydrogen phosphate), which are not accepted by the wild-type.
4b2xB Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
68% identity, 98% coverage: 2:281/286 of query aligns to 13:293/302 of 4b2xB
4arwA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
68% identity, 98% coverage: 2:281/286 of query aligns to 5:285/294 of 4arwA
- binding n-(6-amino-1-butyl-2,4-dioxo-1,2,3,4-tetrahydropyrimidin-5-yl)-n-methyl-benzenesulfonamide: S42 (= S39), L46 (= L43), Y114 (≠ F111), Y115 (≠ H112), G116 (≠ S113), V251 (≠ I247), A252 (≠ G248), E256 (= E252)
5fuhA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor
68% identity, 98% coverage: 2:281/286 of query aligns to 9:289/298 of 5fuhA
- binding N-[6-amino-1-(3-bromobenzyl)-2,4-dioxo-1,2,3,4-tetrahydropyrimidin-5-yl]-N-methylbenzenesulfonamide: T47 (= T40), L50 (= L43), Y118 (≠ F111), G120 (≠ S113), F123 (≠ L116), A256 (≠ G248), R264 (= R256), Q265 (≠ M257)
4b4bA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
68% identity, 98% coverage: 2:281/286 of query aligns to 9:289/298 of 4b4bA
4b4mA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
68% identity, 98% coverage: 2:281/286 of query aligns to 7:287/296 of 4b4mA
- binding N-(6-amino-1-benzyl-2,4-dioxo-1,2,3,4-tetrahydropyrimidin-5-yl)-4-fluoro-N-methylbenzenesulfonamide: S44 (= S39), T45 (= T40), L48 (= L43), Y116 (≠ F111), G118 (≠ S113), V253 (≠ I247), A254 (≠ G248), E258 (= E252), I259 (= I253), R262 (= R256)
5fyeA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor
68% identity, 98% coverage: 2:281/286 of query aligns to 7:287/296 of 5fyeA
- binding N-(6-Amino-1-(3-fluorobenzyl)-2,4-dioxo-1,2,3,4-tetrahydropyrimidin-5-yl)-N-methylbenzenesulfonamide: S44 (= S39), L48 (= L43), Y116 (≠ F111), G118 (≠ S113), V253 (≠ I247), A254 (≠ G248), E258 (= E252), R262 (= R256)
5fu0A Pseudomonas aeruginosa rmla in complex with allosteric inhibitor
68% identity, 98% coverage: 2:281/286 of query aligns to 7:287/296 of 5fu0A
- binding n-(6-amino-1-(3-methylbenzyl)-2,4-dioxo-1,2,3,4-tetrahydropyrimidin-5-yl)-n-methylbenzenesulfonamide: S44 (= S39), L48 (= L43), Y116 (≠ F111), Y117 (≠ H112), G118 (≠ S113), H122 (≠ A117), V253 (≠ I247), A254 (≠ G248), E258 (= E252), Q263 (≠ M257)
5ftvA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor
68% identity, 98% coverage: 2:281/286 of query aligns to 7:287/296 of 5ftvA
- binding n-(6-amino-1-(4-bromobenzyl)-2,4-dioxo-1,2,3,4-tetrahydropyrimidin-5-yl)-n-methylbenzenesulfonamide: S44 (= S39), L48 (= L43), Y116 (≠ F111), Y117 (≠ H112), G118 (≠ S113), F121 (≠ L116), V253 (≠ I247), A254 (≠ G248), E258 (= E252), R262 (= R256), Q263 (≠ M257)
5ftsA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor
68% identity, 98% coverage: 2:281/286 of query aligns to 7:287/296 of 5ftsA
- binding N-(6-Amino-1-(2-bromobenzyl)-2,4-dioxo-1,2,3,4-tetrahydropyrimidin-5-yl)-N-methylbenzenesulfonamide: S44 (= S39), L48 (= L43), Y116 (≠ F111), G118 (≠ S113), H122 (≠ A117), V253 (≠ I247), A254 (≠ G248), E258 (= E252), I259 (= I253)
3zllA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
68% identity, 98% coverage: 2:281/286 of query aligns to 8:288/297 of 3zllA
3zlkA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
68% identity, 98% coverage: 2:281/286 of query aligns to 8:288/297 of 3zlkA
- binding n-(6-amino-1-benzyl-2,4-dioxo-1,2,3,4-tetrahydropyrimidin-5-yl)benzenesulfonamide: S45 (= S39), L49 (= L43), Y117 (≠ F111), Y118 (≠ H112), G119 (≠ S113), V254 (≠ I247), A255 (≠ G248), E259 (= E252), I260 (= I253)
5fu8A Pseudomonas aeruginosa rmla in complex with allosteric inhibitor
68% identity, 98% coverage: 2:281/286 of query aligns to 8:288/297 of 5fu8A
- binding N-(6-amino-1-(4-bromo-3-methylbenzyl)-2,4-dioxo-1,2,3,4-tetrahydropyrimidin-5-yl)-N-methylbenzenesulfonamide: S45 (= S39), L49 (= L43), Y117 (≠ F111), Y118 (≠ H112), G119 (≠ S113), H123 (≠ A117), V254 (≠ I247), E259 (= E252), R263 (= R256), Q264 (≠ M257)
4b2wA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
68% identity, 98% coverage: 2:281/286 of query aligns to 8:288/297 of 4b2wA
4asjA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
68% identity, 98% coverage: 2:281/286 of query aligns to 3:283/292 of 4asjA
- binding N-(6-amino-1-benzyl-2,4-dioxo-1,2,3,4-tetrahydropyrimidin-5-yl)-N-methylbenzenesulfonamide: S40 (= S39), L44 (= L43), Y112 (≠ F111), G114 (≠ S113), F117 (≠ L116), V249 (≠ I247), E254 (= E252)
- binding phosphate ion: A155 (= A153), V213 (= V211)
1g3lA The structural basis of the catalytic mechanism and regulation of glucose-1-phosphate thymidylyltransferase (rmla). Tdp-l-rhamnose complex. (see paper)
68% identity, 98% coverage: 2:281/286 of query aligns to 3:283/292 of 1g3lA
- binding 2'-deoxy-thymidine-beta-l-rhamnose: L7 (= L6), G9 (= G8), G10 (= G9), Q81 (= Q80), P84 (= P83), D109 (= D108), Y113 (≠ H112), G114 (≠ S113), H115 (≠ D114), D116 (≠ G115), F117 (≠ L116), H118 (≠ A117), Y144 (= Y142), G145 (= G143), E160 (= E158), K161 (= K159), V171 (= V169), T172 (≠ P170), G173 (= G171), Y175 (= Y173), R193 (= R191), G217 (≠ S215), R218 (= R216), G219 (= G217), E254 (= E252), I255 (= I253), R258 (= R256)
1g2vA The structural basis of the catalytic mechanism and regulation of glucose-1-phosphate thymidylyltransferase (rmla). Ttp complex. (see paper)
68% identity, 98% coverage: 2:281/286 of query aligns to 3:283/292 of 1g2vA
- binding thymidine-5'-triphosphate: L7 (= L6), A8 (= A7), G9 (= G8), G10 (= G9), G12 (= G11), T13 (= T12), R14 (= R13), Q25 (= Q24), Q81 (= Q80), P84 (= P83), L87 (= L86), D109 (= D108), Y113 (≠ H112), G114 (≠ S113), H115 (≠ D114), D116 (≠ G115), F117 (≠ L116), H118 (≠ A117), G217 (≠ S215), R218 (= R216), G219 (= G217), E254 (= E252), I255 (= I253)
Query Sequence
>CA265_RS19325 FitnessBrowser__Pedo557:CA265_RS19325
MKGIILAGGSGTRLHPLTLACSKQMMPVYDKPMIYYPLSTLMLAGIKEILIISTPHDLPN
FQKLLGDGTSLGCKFSYAVQAEPNGLAQAFVIGEEFIGKDKVALVLGDNIFHSDGLAKLL
QASSDPDGGVVFAYQVADPERYGVVEFDGSNKAISIEEKPVQPKSSYAVPGLYFYDNEVV
EIAKNIKPSPRGEYEITDVNRVYLERGKLKVGVLSRGTAWLDTGTFTSLMQAGQFVQIIE
ERQGLKIGCIEEIAYRMGFIDAEQLRAIATPLVKSGYGSYLLKQIK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory